SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esteras...    24   1.3  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    24   1.3  
AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esteras...    24   1.3  
AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esteras...    24   1.3  
AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esteras...    24   1.3  
AF260823-1|AAG02021.1|  138|Tribolium castaneum alpha-esterase l...    24   1.3  
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          23   3.0  
AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.           23   3.0  
AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    22   4.0  
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    22   5.3  
EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    21   7.0  
AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    21   7.0  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    21   7.0  
DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9 prot...    21   9.2  
AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16 pro...    21   9.2  
AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3 prot...    21   9.2  

>AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 57  RDATQDGTPCISRHPVLKSLIGSEDCLTL 85


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 57  RDATQDGTPCISRHPVLKSLIGSEDCLTL 85


>AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 57  RDATQDGTPCISRHPVLKSLIGSEDCLTL 85


>AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esterase
           protein.
          Length = 510

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 57  RDATQDGTPCISRHPVLKSLIGSEDCLTL 85


>AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esterase
           protein.
          Length = 509

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 56  RDATQDGTPCISRHPVLKSLIGSEDCLTL 84


>AF260823-1|AAG02021.1|  138|Tribolium castaneum alpha-esterase like
           protein E4 protein.
          Length = 138

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +1

Query: 361 RDATDDQVTIDSAHAILKHNVGIK-CATI 444
           RDAT D     S H +LK  +G + C T+
Sbjct: 29  RDATQDGTPCISRHPVLKSLIGSEDCLTL 57


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/20 (40%), Positives = 15/20 (75%)
 Frame = +3

Query: 456 TKSRRVQVEENVAKPERKIR 515
           ++ RR+Q+ EN+   ER+I+
Sbjct: 114 SRPRRIQIAENLNLSERQIK 133


>AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.
          Length = 246

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/20 (40%), Positives = 15/20 (75%)
 Frame = +3

Query: 456 TKSRRVQVEENVAKPERKIR 515
           ++ RR+Q+ EN+   ER+I+
Sbjct: 105 SRPRRIQIAENLNLSERQIK 124


>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +2

Query: 59  LLLALQARELVVDPRNHEQW*IHEQYRNMANTSTTK 166
           LLLAL    ++   R  +QW   +  +N+   +TTK
Sbjct: 73  LLLALNISTILTTVRKQQQW--AQLIQNLKVVATTK 106


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/28 (32%), Positives = 15/28 (53%)
 Frame = +1

Query: 268 MTRIMWAKIKERLIFPYVKVDCLYFDLG 351
           +T I  A  K   + PY  ++CL + +G
Sbjct: 202 VTHITMAHFKIIQVVPYCYINCLIYLIG 229


>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 587 DETYCDR 607
           DETYCDR
Sbjct: 38  DETYCDR 44


>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -3

Query: 578 HNPRDTLTQYRFAEYCTAQNVTDLPFGLSHIFFNLNSSTLCS 453
           + P   L++ R     TA  V  LPF + HIF ++  + L S
Sbjct: 32  NTPSFKLSKIRSFLNITASAVL-LPFAIYHIFMHIVPTKLIS 72


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 7/23 (30%), Positives = 13/23 (56%)
 Frame = +1

Query: 532 QYSANRYCVRVSRGLCLVGRNLL 600
           +Y   R  + ++  LCL  +NL+
Sbjct: 243 RYLTRRRRIEIAHALCLTNKNLV 265


>DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9
           protein.
          Length = 383

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +1

Query: 337 YFDLGLPHRDATDDQVTIDSAHAI 408
           Y  L   H D TD+Q T++ A  I
Sbjct: 221 YAPLYASHLDQTDEQKTLNVAAGI 244


>AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16
           protein.
          Length = 384

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +1

Query: 337 YFDLGLPHRDATDDQVTIDSAHAI 408
           Y  L   H D TD+Q T++ A  I
Sbjct: 222 YAPLYASHLDQTDEQKTLNVAAGI 245


>AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3
           protein.
          Length = 384

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +1

Query: 337 YFDLGLPHRDATDDQVTIDSAHAI 408
           Y  L   H D TD+Q T++ A  I
Sbjct: 222 YAPLYASHLDQTDEQKTLNVAAGI 245


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,316
Number of Sequences: 336
Number of extensions: 3376
Number of successful extensions: 17
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17593745
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -