SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    23   2.8  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    23   2.8  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    23   2.8  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   3.7  
AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory recept...    22   4.9  
AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory recept...    22   4.9  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   8.6  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   8.6  

>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = -3

Query: 88  RILH*IIFVTARPPFDAHLRQCLHFESR 5
           R+LH +   T   P+DA   QC++  SR
Sbjct: 83  RLLHDLKGRTTSVPYDALTGQCIYSISR 110


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = -3

Query: 88  RILH*IIFVTARPPFDAHLRQCLHFESR 5
           R+LH +   T   P+DA   QC++  SR
Sbjct: 83  RLLHDLKGRTTSVPYDALTGQCIYSISR 110


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = -3

Query: 88  RILH*IIFVTARPPFDAHLRQCLHFESR 5
           R+LH +   T   P+DA   QC++  SR
Sbjct: 83  RLLHDLKGRTTSVPYDALTGQCIYSISR 110


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 10/47 (21%), Positives = 23/47 (48%)
 Frame = +2

Query: 173 STYEERFVM*SLNWLGIILMTMATTSGRVPTVHVYLCQCARSKHQRS 313
           S YE R++   L+ + +++  +   S  +   HV++      +H+ S
Sbjct: 50  SVYERRYMNAHLSGIQLVVRNLLDISLYLNAYHVFVTMMTLKRHKWS 96


>AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory receptor
           candidate 13 protein.
          Length = 390

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/40 (20%), Positives = 23/40 (57%)
 Frame = +1

Query: 259 SYSSCLPVPVRKIQTSKKLVLECLRLYQVYLEIVRLKTWM 378
           SY+  +   V   +  ++ +L  ++LY +Y +++ + T++
Sbjct: 194 SYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVISTFL 233


>AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory receptor
           candidate 12 protein.
          Length = 316

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/40 (20%), Positives = 23/40 (57%)
 Frame = +1

Query: 259 SYSSCLPVPVRKIQTSKKLVLECLRLYQVYLEIVRLKTWM 378
           SY+  +   V   +  ++ +L  ++LY +Y +++ + T++
Sbjct: 120 SYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVISTFL 159


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +1

Query: 238 GNNQWPSSYSSCLPVPV 288
           G +QW S Y + LP+ V
Sbjct: 913 GLDQWSSFYWNLLPIAV 929


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +1

Query: 238 GNNQWPSSYSSCLPVPV 288
           G +QW S Y + LP+ V
Sbjct: 913 GLDQWSSFYWNLLPIAV 929


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,609
Number of Sequences: 336
Number of extensions: 3462
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16292796
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -