SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        26   0.29 
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    23   2.7  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    21   6.3  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    21   6.3  

>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 25.8 bits (54), Expect = 0.29
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 39  GKIIVQIGPVVSEPIRNRQTNKSFLFIIL 125
           GK  V + PVVSEPI +++     + + L
Sbjct: 218 GKFTVPLTPVVSEPIYDKKAMSDLMIVKL 246


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 10/38 (26%), Positives = 18/38 (47%)
 Frame = +1

Query: 301 LVGSRIRSFTSKMSVFKILLSSIIHIHVCQFIMFILCE 414
           LV  + R    ++S  K   + +  +  C   +F+LCE
Sbjct: 388 LVNLKYRETYFRLSKTKTFCTLVTALVYCSLAIFVLCE 425


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 565 CYFHIKYSNIRMLFTSR 615
           C F  KY NI +L T +
Sbjct: 167 CIFRGKYRNINLLLTEQ 183


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 6/15 (40%), Positives = 11/15 (73%)
 Frame = -1

Query: 172 KNIYYLFIYNLKFIY 128
           KN+YYL ++ +  +Y
Sbjct: 97  KNLYYLLLFVINVLY 111


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,877
Number of Sequences: 336
Number of extensions: 2636
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15875032
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -