SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    25   0.58 
DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11 pro...    24   1.0  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    23   2.4  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 25.0 bits (52), Expect = 0.58
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = +1

Query: 454 SRNTVSWALRLCLTTNSKLDENCIGNGIELRHR 552
           +R T++W  +L + +N  L+E      ++L HR
Sbjct: 595 ARATLNWVSKLIIRSNPSLEEKLQIFALQLTHR 627



 Score = 21.8 bits (44), Expect = 5.4
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +1

Query: 490 LTTNSKLDENCIGNGIELRHREDLLV 567
           + T +  DE     G+E+ H+ED  V
Sbjct: 394 VNTVATFDETWAKLGLEINHKEDFRV 419


>DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11
           protein.
          Length = 366

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +3

Query: 303 EWEYTSNITKENEEKSIQ 356
           +WEY +N  KEN  K +Q
Sbjct: 144 DWEYPANADKENFVKLLQ 161


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +2

Query: 290 GQLSRMGVHLEYHEGER 340
           G+ S +  HL +H GER
Sbjct: 327 GKTSHLKAHLRWHTGER 343


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,609
Number of Sequences: 336
Number of extensions: 3057
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18114270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -