SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    24   0.93 
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    23   2.8  
AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory recept...    23   2.8  
DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped prot...    22   5.0  
AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like prote...    22   5.0  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    22   5.0  
AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory recept...    21   6.6  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    21   6.6  
AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory recept...    21   8.7  
AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    21   8.7  
AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory recept...    21   8.7  

>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 24.2 bits (50), Expect = 0.93
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = -2

Query: 296 CCIDSYCSS*FRCYQFCYTQY*STPEQPVQ*HLRRFFYCFSFTNNRYVVWFQMSVKIIFY 117
           C +  + ++ F       TQY   PE+ V   +   F CFS   +     F +   +IF+
Sbjct: 191 CLLAWFIAALFTSPILAITQY--GPEEYVDGSI--VFVCFSLVEDTLPCVFFLGSILIFF 246

Query: 116 LNPMCMLPI*VGIIDYTL 63
           + P+ +L I   +I  TL
Sbjct: 247 IFPLAILIIVYILIAKTL 264


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/29 (31%), Positives = 13/29 (44%)
 Frame = +1

Query: 343 GSFH*IQV*CRSTYGTCWPECC*CHCQGL 429
           G +  +   C +   TCW EC    C+ L
Sbjct: 869 GEYKCVTCKCENGKPTCWRECDKATCEKL 897


>AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory receptor
           candidate 36 protein.
          Length = 355

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = +3

Query: 216 LFGSALILRVAKLITSEL 269
           +FG  LIL +AK ITS L
Sbjct: 223 IFGWTLILILAKCITSSL 240


>DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped
          protein.
          Length = 126

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 7/16 (43%), Positives = 9/16 (56%)
 Frame = -1

Query: 60 WYDMYYYVLFFNLHIY 13
          WY+ YYY    N  +Y
Sbjct: 37 WYNPYYYQYLQNAALY 52


>AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like protein
           protein.
          Length = 314

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = -3

Query: 433 WEDLGNGTSNTQASKFHKLID 371
           WE L   T  ++ SK  +L+D
Sbjct: 105 WESLIEVTKTSETSKLQQLVD 125


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/17 (35%), Positives = 13/17 (76%)
 Frame = -3

Query: 259 VISFATRNIRALPNNLY 209
           ++ F+   +R+LP+NL+
Sbjct: 324 IVDFSHNRLRSLPDNLF 340


>AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory receptor
           candidate 52 protein.
          Length = 360

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 8/33 (24%), Positives = 18/33 (54%)
 Frame = +2

Query: 134 LTFGTKLRIYY**KKNSKRIFLNVIVQVVRECS 232
           +T G  + ++Y  K  +K I +  +VQ+  + +
Sbjct: 42  ITLGVAVSVFYRAKDYAKFIHIKAVVQITLDAT 74


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 8/33 (24%), Positives = 18/33 (54%)
 Frame = +2

Query: 134 LTFGTKLRIYY**KKNSKRIFLNVIVQVVRECS 232
           +T G  + ++Y  K  +K I +  +VQ+  + +
Sbjct: 42  ITLGVAVSVFYRAKDYAKFIHIKAVVQITLDAT 74


>AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory
          receptor candidate 56 protein.
          Length = 358

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -1

Query: 72 LYT*WYDMYYYVLFFNLHIYKLV 4
          +YT  + ++Y   FF L  Y LV
Sbjct: 16 VYTAIHPLFYVCTFFGLAPYSLV 38


>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -1

Query: 48  YYYVLFFNLHI 16
           YYY  FF +H+
Sbjct: 115 YYYYAFFGVHL 125


>AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory
          receptor candidate 21 protein.
          Length = 386

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -1

Query: 72 LYT*WYDMYYYVLFFNLHIYKLV 4
          +YT  + ++Y   FF L  Y LV
Sbjct: 16 VYTAIHPLFYVCTFFGLAPYSLV 38


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,102
Number of Sequences: 336
Number of extensions: 3420
Number of successful extensions: 13
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16501678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -