SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax pr...    25   0.53 
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     23   2.8  
AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory recept...    21   6.5  
AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    21   8.6  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    21   8.6  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    21   8.6  

>AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax
           protein.
          Length = 314

 Score = 25.0 bits (52), Expect = 0.53
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = -1

Query: 294 KSIPITVPMSLSFSSCRRHK--RPRPPKLARTNSTAS*PCKIYRLKDSEINKN 142
           +S P+++ MS   SS   H   + RPP+ +  +++ +  CK+Y   + + N N
Sbjct: 37  RSFPLSLGMSPYASSQHHHHHLQARPPQDSPYDASVAAACKLYS-SEGQQNSN 88


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 7/22 (31%), Positives = 11/22 (50%)
 Frame = -2

Query: 326 CRHRHMSKWYPNRYRLLCRCPY 261
           CR+  + +WY    +    CPY
Sbjct: 57  CRYTFLLEWYHTLSKACYDCPY 78


>AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory receptor
           candidate 50 protein.
          Length = 350

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 183 CKIYRLKDSEINKNLNKIIF 124
           C   +LK  EI  ++NK+IF
Sbjct: 288 CDKVQLKIGEIKYSVNKLIF 307


>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 366 TASHLHTWP 392
           T +HLH WP
Sbjct: 208 TPNHLHIWP 216


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 366 TASHLHTWP 392
           T +HLH WP
Sbjct: 208 TPNHLHIWP 216


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 366 TASHLHTWP 392
           T +HLH WP
Sbjct: 208 TPNHLHIWP 216


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,803
Number of Sequences: 336
Number of extensions: 3415
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16397237
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -