SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    27   0.18 
AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.    22   3.8  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    22   3.8  
DQ855490-1|ABH88177.1|  133|Tribolium castaneum chemosensory pro...    21   8.7  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   8.7  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 26.6 bits (56), Expect = 0.18
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +3

Query: 174 SEDFRQKIHGQVRSCVQTATRGS 242
           +ED+RQ++H QV  C+   + GS
Sbjct: 87  AEDYRQEVHAQVYVCLAKNSVGS 109


>AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.
          Length = 209

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/15 (46%), Positives = 8/15 (53%)
 Frame = -2

Query: 276 LCPNLCSAYLVCFLG 232
           LC N C  Y+ C  G
Sbjct: 11  LCDNFCHRYISCLKG 25


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/15 (46%), Positives = 8/15 (53%)
 Frame = -2

Query: 276 LCPNLCSAYLVCFLG 232
           LC N C  Y+ C  G
Sbjct: 167 LCDNFCHRYISCLKG 181


>DQ855490-1|ABH88177.1|  133|Tribolium castaneum chemosensory
           protein 4 protein.
          Length = 133

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 8/32 (25%), Positives = 16/32 (50%)
 Frame = -3

Query: 443 HWKILQSIFFVQNNYKSSFQSHTSNEVKIVDS 348
           +WK L++ +     YK  +     +EV  V++
Sbjct: 102 YWKALEAKYDPDGTYKKRYFESQKDEVSKVEA 133


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -1

Query: 550 IRRIFYLSH*IITKNIFICFIL 485
           +RRI+Y     IT N+ + F+L
Sbjct: 53  LRRIYYFYCVSITFNVHLLFLL 74


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,316
Number of Sequences: 336
Number of extensions: 3220
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16656800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -