SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory recept...    26   0.26 
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    26   0.26 
AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory recept...    25   0.61 
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    24   1.1  
AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esteras...    23   1.9  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    23   1.9  
AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esteras...    23   1.9  
AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esteras...    23   1.9  
AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esteras...    23   1.9  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    23   3.3  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    22   4.3  
AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory recept...    22   4.3  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    21   7.5  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   7.5  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   9.9  

>AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory receptor
           candidate 52 protein.
          Length = 360

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 16/60 (26%), Positives = 29/60 (48%)
 Frame = +1

Query: 529 ILFPTRYQPIYVLHYLHQYIVYCSLDILFY*QHFPVVFIVNSSTALAWHTAHGISIVFFC 708
           ILF   Y  + +L YLH  ++    DI      + +V+I+     + W+T +  + +F C
Sbjct: 229 ILFLITYATLQILVYLHLAVMLGFQDI------YMIVYII---VVIFWYTVNASTNIFLC 279


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 16/60 (26%), Positives = 29/60 (48%)
 Frame = +1

Query: 529 ILFPTRYQPIYVLHYLHQYIVYCSLDILFY*QHFPVVFIVNSSTALAWHTAHGISIVFFC 708
           ILF   Y  + +L YLH  ++    DI      + +V+I+     + W+T +  + +F C
Sbjct: 229 ILFLITYATLQILVYLHLAVMLGFQDI------YMIVYII---VVIFWYTVNASTNIFLC 279


>AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory receptor
           candidate 2 protein.
          Length = 587

 Score = 25.0 bits (52), Expect = 0.61
 Identities = 10/18 (55%), Positives = 15/18 (83%)
 Frame = +3

Query: 375 GLILNFVDFMVPVICNQL 428
           GLIL+FVD+ V ++C+ L
Sbjct: 389 GLILSFVDYFVFLLCSIL 406


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +2

Query: 557 FMYYTISISTLCTVAWISSSINNIF 631
           + YY+ISI  + T+ W   S+  I+
Sbjct: 555 YCYYSISIRPISTLGWFFWSLLRIY 579


>AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +3

Query: 474 EICRSIVISYNNW*FTSIHSIPYEIP 551
           ++C  +  ++NN  F   H IPY  P
Sbjct: 12  KLCGKVGKNFNNKAFFCFHGIPYAKP 37


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +3

Query: 474 EICRSIVISYNNW*FTSIHSIPYEIP 551
           ++C  +  ++NN  F   H IPY  P
Sbjct: 12  KLCGKVGKNFNNKAFFCFHGIPYAKP 37


>AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +3

Query: 474 EICRSIVISYNNW*FTSIHSIPYEIP 551
           ++C  +  ++NN  F   H IPY  P
Sbjct: 12  KLCGKVGKNFNNEAFFCFHGIPYAKP 37


>AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esterase
           protein.
          Length = 510

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +3

Query: 474 EICRSIVISYNNW*FTSIHSIPYEIP 551
           ++C  +  ++NN  F   H IPY  P
Sbjct: 12  KLCGKVGKNFNNEAFFCFHGIPYAKP 37


>AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esterase
           protein.
          Length = 509

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = +3

Query: 474 EICRSIVISYNNW*FTSIHSIPYEIP 551
           ++C  +  ++NN  F   H IPY  P
Sbjct: 11  KLCGKVGKNFNNEAFFCFHGIPYAKP 36


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 10/42 (23%), Positives = 20/42 (47%)
 Frame = -1

Query: 503 VAYYNASTNFFKCLLVLSCPRTRSIKLVAYNWYHKINKIKNE 378
           +A+++A  +     L L+C      K +     H++ +I NE
Sbjct: 293 IAFFSAGNDTTSITLALTCYELSLNKTIQDRLRHEVTEIYNE 334


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +3

Query: 603 GYPLLLTTFSCCI 641
           GY ++L  F CC+
Sbjct: 242 GYQIILVIFDCCL 254


>AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory receptor
           candidate 22 protein.
          Length = 301

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = +3

Query: 261 VILWEQQWHPCAIVGSMTIMYLLIWLL 341
           ++++   W+P  I+G M     LI+LL
Sbjct: 85  ILIFLVNWYPRLIIGIMNSTLNLIFLL 111


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +3

Query: 45  TSNNFLVIYEKRNRIALLIKFLI 113
           T  N+L++  K N   +L K+L+
Sbjct: 15  TQPNYLILSNKNNTYLVLNKYLL 37


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +1

Query: 556 IYVLHYLHQYIVYCSLDILFY*QHFPVVFIV 648
           +++L  L  Y  YC+L IL    +F   FI+
Sbjct: 277 MHLLFLLCIYYFYCALIILLCIYYFCRAFII 307


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -3

Query: 597  TVHNVLMEIV*YINGLVS 544
            T+HNV+ + + Y  GL++
Sbjct: 1234 TIHNVIGQFLGYFIGLIT 1251


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,221
Number of Sequences: 336
Number of extensions: 3848
Number of successful extensions: 15
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18947110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -