SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     24   1.3  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   5.3  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    22   5.3  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    22   5.3  
AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    21   7.1  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    21   7.1  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    21   7.1  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    21   7.1  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    21   7.1  
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    21   7.1  
AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax pr...    21   7.1  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    21   7.1  
DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    21   9.3  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   9.3  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 10/32 (31%), Positives = 14/32 (43%)
 Frame = -3

Query: 178 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 83
           K PG S     GD + + V  H     T++ W
Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 11/44 (25%), Positives = 22/44 (50%)
 Frame = +2

Query: 518 QLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRL 649
           ++D  + +++ +  F  G     + GR+   V T+  PRE  R+
Sbjct: 134 RIDNESQELLKYPSFARGRSLYDSRGRHSEIVETVYDPREDDRV 177


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 8/30 (26%), Positives = 15/30 (50%)
 Frame = -3

Query: 172 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 83
           PG S +   GD++ + V  H +    ++ W
Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201



 Score = 21.0 bits (42), Expect = 9.3
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLG 111
           + R P +++K++N   A  LD+ G
Sbjct: 609 IGRSPDQNVKKINLKHALDLDRRG 632


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 8/30 (26%), Positives = 15/30 (50%)
 Frame = -3

Query: 172 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 83
           PG S +   GD++ + V  H +    ++ W
Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201



 Score = 21.0 bits (42), Expect = 9.3
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLG 111
           + R P +++K++N   A  LD+ G
Sbjct: 609 IGRSPDQNVKKINLKHALDLDRQG 632


>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 20  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 59


>AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax
           protein.
          Length = 157

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +3

Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491
           H + P    Y   + +R+A+     P   TH   + +Y D
Sbjct: 64  HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103


>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 21.0 bits (42), Expect = 9.3
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +1

Query: 388 RRLSTSCVKSSVWRPDLRMFR 450
           R+++  C+KS  WR  L + +
Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 9.3
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = -1

Query: 585 IIHKFPDSNLMKSIIFVVAMSNWME 511
           II +F    L   +  VV +SNW E
Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWRE 263


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,813
Number of Sequences: 336
Number of extensions: 3969
Number of successful extensions: 19
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17801955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -