SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    26   0.30 
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    26   0.30 
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    26   0.30 
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    26   0.30 
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    26   0.30 
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    26   0.30 
AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax pr...    26   0.30 
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    26   0.30 
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    25   0.40 
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    25   0.40 
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           25   0.40 
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    21   6.5  
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    21   8.6  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   8.6  

>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 33  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 66


>AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax
           protein.
          Length = 157

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLASTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 25.4 bits (53), Expect = 0.40
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 351 CSEACQRSRPTRIAYY 398
           C+ AC+   P RI YY
Sbjct: 108 CARACREGEPPRICYY 123


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 25.4 bits (53), Expect = 0.40
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 351 CSEACQRSRPTRIAYY 398
           C+ AC+   P RI YY
Sbjct: 108 CARACREGEPPRICYY 123


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.40
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 477 QRQQLVLEHVPRIGTLVHQI*FCYYADSTQSLWV 376
           Q Q+L   H+    T  H    C YADST S  V
Sbjct: 77  QPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGV 110


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = +1

Query: 244 YRYRQQIKGMIFQFIRRESCLILAVTPANTD 336
           + Y+Q +   +  FI   +C+ +A T  +TD
Sbjct: 156 FDYKQPVVFDLVYFILAFACISIAYTNVSTD 186


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = -3

Query: 462 VLEHVPRIGTLVHQI 418
           VL+ V ++ TLVHQ+
Sbjct: 498 VLDSVEKLETLVHQL 512


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +1

Query: 172  FPECAQPDAD*FAGSDKSA 228
            +P+C Q D +    SDKSA
Sbjct: 1946 YPKCWQVDCNKGPASDKSA 1964


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,454
Number of Sequences: 336
Number of extensions: 2841
Number of successful extensions: 18
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16397237
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -