SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   1.3  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   1.7  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    23   1.7  
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    22   2.9  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   5.1  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    21   5.1  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   6.8  
DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory pro...    21   8.9  
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    21   8.9  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   8.9  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.4 bits (48), Expect = 1.3
 Identities = 13/54 (24%), Positives = 19/54 (35%)
 Frame = +2

Query: 86  TWNYSALHVHESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCD 247
           T +Y+ +   E + SWR     +      G      P    S V    +C  CD
Sbjct: 501 TQHYTNIISQEQIISWRSSDDAKGGGGGSGSGNNQPPGGPSSHVSAVLTCKVCD 554


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 180 PHKVYHGKTGR 212
           PH  Y GKTGR
Sbjct: 302 PHPTYFGKTGR 312


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 13/55 (23%), Positives = 22/55 (40%)
 Frame = -1

Query: 263 EHAVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGER 99
           +H V+ H   +     H +  S+   +W T+    +  D Y V     FH+   R
Sbjct: 231 KHLVNLHKNLVKVAKDHNSLYSLHLLLWITVTFILLVGDSYIVMYVFFFHLSDVR 285


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 8/19 (42%), Positives = 12/19 (63%), Gaps = 1/19 (5%)
 Frame = +2

Query: 80  PHT-WNYSALHVHESVQSW 133
           PH  W Y  L+V++ +Q W
Sbjct: 234 PHDQWAYEKLNVNDGLQLW 252



 Score = 21.0 bits (42), Expect = 6.8
 Identities = 9/31 (29%), Positives = 13/31 (41%)
 Frame = +1

Query: 349 QRE*EATEGSQGCRQDRQPEETASSP*SCPH 441
           Q E + +   + C+QD  P E       C H
Sbjct: 466 QNEVDGSVAPKECKQDFMPHELCDKYYRCVH 496


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 12/46 (26%), Positives = 20/46 (43%)
 Frame = -1

Query: 254 VDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 117
           V  H+  +++        S+   VW +L+   +  D Y V N V F
Sbjct: 221 VQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 12/46 (26%), Positives = 20/46 (43%)
 Frame = -1

Query: 254 VDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 117
           V  H+  +++        S+   VW +L+   +  D Y V N V F
Sbjct: 221 VQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.0 bits (42), Expect = 6.8
 Identities = 8/19 (42%), Positives = 9/19 (47%)
 Frame = +3

Query: 414 SQLPLKLPTSSVELRNPSY 470
           S  P  LPT      NP+Y
Sbjct: 78  SSTPSSLPTQRTSTSNPTY 96


>DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory
           protein 8 protein.
          Length = 99

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 7/23 (30%), Positives = 12/23 (52%)
 Frame = +2

Query: 230 SCSRCDCQQRVRGRIIPKRINIR 298
           +C RCD +Q    R I + +  +
Sbjct: 63  NCERCDSRQVANARRIARYVQTK 85


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -2

Query: 226 VTLYTRPVFPWYTLCGIP 173
           V L    +  WYT+C +P
Sbjct: 9   VNLGLNGLIDWYTVCLVP 26


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 370 EGSQGCRQDRQPEETASSP 426
           +G  G  Q   PE ++S+P
Sbjct: 413 DGGSGQNQPESPESSSSTP 431


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,913
Number of Sequences: 336
Number of extensions: 2468
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12887571
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -