SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    22   4.3  
AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein p...    22   4.3  
AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein p...    22   4.3  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    22   4.3  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   5.6  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   5.6  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   7.5  
AY600514-1|AAT11862.1|  242|Tribolium castaneum iroquois-like pr...    21   7.5  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    21   9.9  

>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 309 PLVDLRNPGPPQHQEHETQNPEHHED 386
           P ++ +N   P  + HE     HHE+
Sbjct: 96  PPINHQNYNEPYQRTHENMLLRHHEE 121


>AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein
           protein.
          Length = 210

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 309 PLVDLRNPGPPQHQEHETQNPEHHED 386
           P ++ +N   P  + HE     HHE+
Sbjct: 96  PPINHQNYNEPYQRTHENMLLRHHEE 121


>AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein
           protein.
          Length = 253

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 309 PLVDLRNPGPPQHQEHETQNPEHHED 386
           P ++ +N   P  + HE     HHE+
Sbjct: 96  PPINHQNYNEPYQRTHENMLLRHHEE 121


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +3

Query: 345 HQEHETQNPEHHE 383
           HQ+H  QN  H E
Sbjct: 314 HQQHHQQNMSHEE 326


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +1

Query: 52   PHAQPAIPDKVPEAEDKPLNVVDNLSSEQE 141
            P+A   I +K PE +DK L  +   + + E
Sbjct: 1045 PNAVQKIEEKKPEKKDKVLTFLGANAQDDE 1074


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +1

Query: 52   PHAQPAIPDKVPEAEDKPLNVVDNLSSEQE 141
            P+A   I +K PE +DK L  +   + + E
Sbjct: 1045 PNAVQKIEEKKPEKKDKVLTFLGANAQDDE 1074


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 7.5
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 199 KEVIDIPVKVIVEEIKP 249
           KEV D+P   + E  KP
Sbjct: 25  KEVFDVPNNFLPERYKP 41


>AY600514-1|AAT11862.1|  242|Tribolium castaneum iroquois-like
           protein protein.
          Length = 242

 Score = 21.0 bits (42), Expect = 7.5
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +1

Query: 409 SKMTLTQRKSLFVKASRK 462
           +KMTLTQ  + F  A R+
Sbjct: 124 TKMTLTQVSTWFANARRR 141


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 20.6 bits (41), Expect = 9.9
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -1

Query: 189 AEAVIDVFNGISLVDELL 136
           A  +ID+F G+  VD+LL
Sbjct: 91  AGRLIDIFLGMRNVDDLL 108


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 110,599
Number of Sequences: 336
Number of extensions: 2276
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14203976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -