SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cogna...    64   1e-12
AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock prote...    64   1e-12
AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    58   6e-11
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    26   0.28 
EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   2.6  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    23   3.4  
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    23   3.4  
AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    23   3.4  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    23   3.4  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    23   3.4  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    23   3.4  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    23   3.4  
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    23   3.4  
AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax pr...    23   3.4  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    23   3.4  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    22   6.0  
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    22   6.0  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           22   6.0  
AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory recept...    21   8.0  
AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory recept...    21   8.0  

>AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cognate
           70 protein.
          Length = 196

 Score = 64.1 bits (149), Expect = 1e-12
 Identities = 35/56 (62%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +3

Query: 585 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           INEPTAAAIAYGLDKK   ERNVLIFDLGGGT     L         +   GDTHL
Sbjct: 1   INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 56


>AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock protein
           70 protein.
          Length = 196

 Score = 64.1 bits (149), Expect = 1e-12
 Identities = 35/56 (62%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +3

Query: 585 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           INEPTAAAIAYGLDKK   ERNVLIFDLGGGT     L         +   GDTHL
Sbjct: 1   INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 56


>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 58.4 bits (135), Expect = 6e-11
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +3

Query: 585 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           INEPTAAAIAYGLDKKG  E+N+L++DLGGGT     L             GDTHL
Sbjct: 1   INEPTAAAIAYGLDKKG-AEQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHL 55


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 26.2 bits (55), Expect = 0.28
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 3/70 (4%)
 Frame = +2

Query: 179 DHSVLCCVHRHRASHRRCRQEPGGDDPNNTIFDAKRLI--GRKFEDATVQADMKHWPFE- 349
           DH  +  +H +  SH   +QEP G   +N  F   RL+       D  + ADM  + +  
Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398

Query: 350 LSVMEANLRS 379
           LS + +++ S
Sbjct: 399 LSPLPSSVHS 408


>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 483
           D  KPKI+   + ED+    E+       K K T +  L KT
Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 131 LPAREGGDHRQRPGQQDH 184
           +P R+  DHR RP +  H
Sbjct: 246 IPIRQCDDHRDRPPRHFH 263


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 540 TKDAGTISGLNVLRIINEPTAA 605
           TKDAG +S   +  ++N+P  A
Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351


>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 26  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 70


>AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax
           protein.
          Length = 157

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q     +T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = -2

Query: 692 WTRRSTAAEVKDKYIS 645
           WT   T A+V +KY+S
Sbjct: 437 WTSHLTQADVIEKYLS 452


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = +3

Query: 480 NCAECSYHGSAYFNDSQ 530
           N   C Y+  AYF D Q
Sbjct: 19  NKVVCYYNSKAYFRDGQ 35


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 13/45 (28%), Positives = 19/45 (42%)
 Frame = +3

Query: 222 IGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ 356
           +GD  + Q      T    PN  +  S+       T STG++S Q
Sbjct: 70  MGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQ 114


>AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory receptor
           candidate 44 protein.
          Length = 313

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 674 RYFDVSILTIEEVS 715
           RYF+V +LTI  VS
Sbjct: 225 RYFEVQVLTIFGVS 238


>AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory receptor
           candidate 4 protein.
          Length = 309

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 674 RYFDVSILTIEEVS 715
           RYF+V +LTI  VS
Sbjct: 221 RYFEVQVLTIFGVS 234


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 192,717
Number of Sequences: 336
Number of extensions: 4505
Number of successful extensions: 25
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20027417
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -