SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cogna...   107   9e-26
AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock prote...   107   9e-26
AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    98   8e-23
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    28   0.070
EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   2.6  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    23   3.5  
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    23   3.5  
Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor ...    22   4.6  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    22   4.6  
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    21   8.1  

>AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cognate
           70 protein.
          Length = 196

 Score =  107 bits (257), Expect = 9e-26
 Identities = 50/57 (87%), Positives = 53/57 (92%)
 Frame = +1

Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           INEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 1   INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57


>AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock protein
           70 protein.
          Length = 196

 Score =  107 bits (257), Expect = 9e-26
 Identities = 50/57 (87%), Positives = 53/57 (92%)
 Frame = +1

Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           INEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 1   INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57


>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 97.9 bits (233), Expect = 8e-23
 Identities = 44/57 (77%), Positives = 53/57 (92%)
 Frame = +1

Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           INEPTAAAIAYGLDKKG  E+N+L++DLGGGTFDVSILTI++G+FEV +T+GDTH G
Sbjct: 1   INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLG 56


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 28.3 bits (60), Expect = 0.070
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%)
 Frame = +2

Query: 182 DHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLI--GRKFEDATVQADMKHWPFEV 355
           DH  +  +H +  SH   +QEP G   +N  F   RL+       D  + ADM  + +  
Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398

Query: 356 VS 361
           +S
Sbjct: 399 LS 400


>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +2

Query: 362 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 487
           D  KPKI+   + ED+    E+       K K T +  L KT
Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 134 LPAREGGDHRQRPGQQDH 187
           +P R+  DHR RP +  H
Sbjct: 246 IPIRQCDDHRDRPPRHFH 263


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 544 TKDAGTISGLNVLRIINEPTAA 609
           TKDAG +S   +  ++N+P  A
Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351


>Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor
           5-like protein protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 9/20 (45%), Positives = 9/20 (45%)
 Frame = +1

Query: 466 RSLSWQNCAECSYHVPAYFN 525
           RS   Q C  C YH P   N
Sbjct: 29  RSTISQGCKACGYHSPLESN 48


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 10/42 (23%), Positives = 20/42 (47%)
 Frame = +1

Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRII 591
           R+ +  N A+   H PA     +   TK++G ++   V  ++
Sbjct: 336 RTFTLSNTAKFGVHAPASGGGKEGTYTKESGFLAYYEVCELL 377


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = -1

Query: 510 NVITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCF- 334
           ++ITAF +VLP+ A  +++ F     L    K   +   Y +  + +  ++   +  C+ 
Sbjct: 86  DLITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYP 145

Query: 333 MSACTVASSNLRPMRRLA 280
           ++ C+  S   + M  LA
Sbjct: 146 LTYCSWTSRRSKVMVYLA 163


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,292
Number of Sequences: 336
Number of extensions: 4435
Number of successful extensions: 14
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20338724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -