SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    25   0.57 
AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    25   0.57 
AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esteras...    25   0.57 
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    25   0.75 
AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esteras...    25   0.75 
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    24   1.00 
EF222298-1|ABN79658.1|  120|Tribolium castaneum ion transport pe...    23   3.0  
AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450 ...    23   3.0  
AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle pr...    23   3.0  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    22   5.3  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    22   5.3  
EF222289-1|ABN79649.1|   68|Tribolium castaneum adipokinetic hor...    21   9.3  

>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 25.0 bits (52), Expect = 0.57
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 149 VQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLL-SMKLISSGVMVEVDMLRF 325
           +QDE  +K++   L    +S+   + L A+F +  F +D++ + KL++  +      L+F
Sbjct: 362 LQDEVSQKIRKYYLGEKKLSKKTFRELVAMFSDRIFINDIVKTAKLMAKSMKSPTYALKF 421

Query: 326 KTR 334
           + R
Sbjct: 422 EYR 424


>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 25.0 bits (52), Expect = 0.57
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 149 VQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLL-SMKLISSGVMVEVDMLRF 325
           +QDE  +K++   L    +S+   + L A+F +  F +D++ + KL++  +      L+F
Sbjct: 362 LQDEVSQKIRKYYLGEKKLSKKTFRELVAMFSDRIFINDIVKTAKLMAKSMKSPTYALKF 421

Query: 326 KTR 334
           + R
Sbjct: 422 EYR 424


>AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 25.0 bits (52), Expect = 0.57
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 149 VQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLL-SMKLISSGVMVEVDMLRF 325
           +QDE  +K++   L    +S+   + L A+F +  F +D++ + KL++  +      L+F
Sbjct: 362 LQDEVSQKIRKYYLGEKKLSKKTFRDLVAMFSDRIFINDIVKTAKLMAKSMKSPTYALKF 421

Query: 326 KTR 334
           + R
Sbjct: 422 EYR 424


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 24.6 bits (51), Expect = 0.75
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +3

Query: 477 YRNILFEFTYTVYNSDITDQNVH 545
           +  I+F F Y  YNS +T   V+
Sbjct: 265 FNTIVFSFCYCYYNSKMTKDGVY 287


>AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 24.6 bits (51), Expect = 0.75
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 149 VQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLL-SMKLISSGVMVEVDMLRF 325
           +QDE  +K++   L    +S+   + L A+F +  F +D++ + KL++  +      L+F
Sbjct: 362 LQDEVSQKIRKYYLGEKKLSKRTFRELVAMFSDRIFINDIVKTAKLMAKSMKSPTYALKF 421

Query: 326 KTR 334
           + R
Sbjct: 422 EYR 424


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 24.2 bits (50), Expect = 1.00
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -2

Query: 526 MSLLYTVYVNSNSIFLYNFYMVFYKV 449
           +SLL  V+V    I+L+  Y ++Y V
Sbjct: 138 VSLLQLVFVFCYFIYLFTVYYIYYSV 163


>EF222298-1|ABN79658.1|  120|Tribolium castaneum ion transport
           peptide isoform B protein.
          Length = 120

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = -3

Query: 468 TWYFIRCVETIVLS 427
           T YF+ CVE+++LS
Sbjct: 92  TKYFVGCVESLLLS 105


>AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 463

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +3

Query: 495 EFTYTVYNSDITDQNVHYYHLVKP 566
           E    +Y    TD+ V YYH + P
Sbjct: 13  EIIADIYRQFPTDRYVGYYHFMTP 36


>AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle
           protein.
          Length = 361

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +2

Query: 140 LHIVQDEFDE-KVQCKVLDCDSISQVKSKILDALFKNTPF 256
           + I+  +F   ++Q K   C+++  ++S+ LDA  K   F
Sbjct: 198 VQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF 237


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = -1

Query: 566 RFYQMIIMHVLISNVAIVYG 507
           RFY    + +L++NVAI +G
Sbjct: 525 RFYIACGIMILVANVAISFG 544


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = -1

Query: 566 RFYQMIIMHVLISNVAIVYG 507
           RFY    + +L++NVAI +G
Sbjct: 525 RFYIACGIMILVANVAISFG 544


>EF222289-1|ABN79649.1|   68|Tribolium castaneum adipokinetic
           hormone 2 protein.
          Length = 68

 Score = 21.0 bits (42), Expect = 9.3
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = +2

Query: 95  EEKLLKEQIDYQTVTLHIVQDEFDEKVQCK 184
           E    KE +D   +   I+Q+E  + V C+
Sbjct: 35  ESNRCKESVDTIMLIYKIIQNEAQKLVDCE 64


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,282
Number of Sequences: 336
Number of extensions: 3122
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17697850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -