SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   3.1  
U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.    22   4.1  
AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain tran...    22   4.1  
AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.           22   4.1  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +1

Query: 454  GLHWTRMMKIC 486
            GLHW +  KIC
Sbjct: 1134 GLHWNKERKIC 1144


>U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.
          Length = 322

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = -2

Query: 377 RFSYFTLNLTHLGHSTDHVFNHGSFLWSTQFDCVQSG 267
           RFS     L H  +S   + NH      +Q+D  Q G
Sbjct: 59  RFSINQPYLNHFDNSVTPMVNHDFTQHLSQYDTCQQG 95


>AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain
           transcription factor Fushitarazu protein.
          Length = 290

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = -2

Query: 377 RFSYFTLNLTHLGHSTDHVFNHGSFLWSTQFDCVQSG 267
           RFS     L H  +S   + NH      +Q+D  Q G
Sbjct: 59  RFSINQPYLNHFDNSVTPMVNHDFTQHLSQYDTCQQG 95


>AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.
          Length = 290

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = -2

Query: 377 RFSYFTLNLTHLGHSTDHVFNHGSFLWSTQFDCVQSG 267
           RFS     L H  +S   + NH      +Q+D  Q G
Sbjct: 59  RFSINQPYLNHFDNSVTPMVNHDFTQHLSQYDTCQQG 95


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,203
Number of Sequences: 336
Number of extensions: 2793
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -