SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cogna...   141   4e-36
AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock prote...   141   4e-36
AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...   121   5e-30
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    27   0.15 
U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    22   5.7  
EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    21   7.6  

>AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cognate
           70 protein.
          Length = 196

 Score =  141 bits (342), Expect = 4e-36
 Identities = 64/81 (79%), Positives = 74/81 (91%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+V +  Q+FK+K+K D
Sbjct: 21  RNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYCTQDFKKKHKAD 80

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRT CERAKRT
Sbjct: 81  ISGNPRALRRLRTQCERAKRT 101



 Score =  132 bits (318), Expect = 4e-33
 Identities = 59/89 (66%), Positives = 78/89 (87%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+TQASIEIDSLF+GID+ T+ITRARFE++N D F+  ++PV+K L+DAK+ K+ 
Sbjct: 99  KRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPVDKVLQDAKIGKSA 158

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H+IVLVGGSTRIPKVQ+L+ ++FNGKEP
Sbjct: 159 VHEIVLVGGSTRIPKVQQLITEYFNGKEP 187


>AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock protein
           70 protein.
          Length = 196

 Score =  141 bits (342), Expect = 4e-36
 Identities = 64/81 (79%), Positives = 74/81 (91%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+V +  Q+FK+K+K D
Sbjct: 21  RNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYCTQDFKKKHKAD 80

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRT CERAKRT
Sbjct: 81  ISGNPRALRRLRTQCERAKRT 101



 Score =  132 bits (318), Expect = 4e-33
 Identities = 59/89 (66%), Positives = 78/89 (87%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+TQASIEIDSLF+GID+ T+ITRARFE++N D F+  ++PV+K L+DAK+ K+ 
Sbjct: 99  KRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPVDKVLQDAKIGKSA 158

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H+IVLVGGSTRIPKVQ+L+ ++FNGKEP
Sbjct: 159 VHEIVLVGGSTRIPKVQQLITEYFNGKEP 187


>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score =  121 bits (292), Expect = 5e-30
 Identities = 51/93 (54%), Positives = 75/93 (80%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L++DLGGGTFDVSILTI++G+FEV +T+GDTHLGGEDFD +++++F++  K+K+
Sbjct: 17  GAEQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLGGEDFDQKVMDYFIKMVKQKH 76

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHKRAL 280
           KKD+  +K+AL++LR   E+AKR     HK  L
Sbjct: 77  KKDIRADKKALQKLRREVEKAKRDLSSVHKTTL 109



 Score =  105 bits (253), Expect = 3e-25
 Identities = 50/90 (55%), Positives = 68/90 (75%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K DLSS  + ++ I++L    DF  ++TRA+FEELN D F  T++PV+K L DA M K
Sbjct: 96  KAKRDLSSVHKTTLTIENLLADYDFSETLTRAKFEELNNDQFLKTLKPVKKVLEDADMTK 155

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            QI +IVLVGGSTRIPK+Q+L++DFF+GKE
Sbjct: 156 DQIDEIVLVGGSTRIPKIQQLIKDFFDGKE 185


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = -1

Query: 427 GFEPY-PSWHHGETSPLAPW*T*TDRRSAPRSEHE 326
           GF P+ PS H G   P  PW T  D R   +  H+
Sbjct: 468 GFGPWKPSMHGGVCDPYTPWHTFYDYRPWVQHGHQ 502


>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = -1

Query: 442 PVQYRGFEPYPSWHHGETSPLAP 374
           PV      P+ + HHG T P +P
Sbjct: 17  PVVLDVIPPHYNIHHGATPPQSP 39


>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -1

Query: 316 CRSQYPQRENLSQCSLVWTMTGPLCPLTCS 227
           C+S Y Q+  ++  +    ++ P C L CS
Sbjct: 29  CKSNYCQKAPITPDTEATGLSLPACRLFCS 58


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,380
Number of Sequences: 336
Number of extensions: 3874
Number of successful extensions: 16
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19051215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -