SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    23   3.1  
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    22   4.1  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    22   4.1  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    22   4.1  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    22   4.1  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    22   5.5  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    21   7.2  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    21   7.2  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   7.2  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    21   9.6  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    21   9.6  

>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = -2

Query: 645 ENGKNIQIKKNDYFIHYILMELV 577
           +NG N    K  YF+  +L++L+
Sbjct: 44  KNGLNYNFTKKCYFLRMVLIDLL 66


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -3

Query: 182 SFSLVVLGTFPLIVMFLLAISLAIRILCL 96
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -3

Query: 182 SFSLVVLGTFPLIVMFLLAISLAIRILCL 96
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -3

Query: 182 SFSLVVLGTFPLIVMFLLAISLAIRILCL 96
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
 Frame = -3

Query: 491 PYVSASRFNPVSVKETSSHDC-TVKGTNGR 405
           PYV+ S ++P S+     + C T K  NG+
Sbjct: 854 PYVNGSEYHP-SIVSLGEYKCVTCKCENGK 882


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = +1

Query: 598 MDKVIVFFYLNIFSI 642
           ++K IVF+  NIFS+
Sbjct: 304 LEKPIVFYVANIFSL 318


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/30 (26%), Positives = 21/30 (70%)
 Frame = -3

Query: 185 SSFSLVVLGTFPLIVMFLLAISLAIRILCL 96
           +S ++ ++GT+   +MF++A S+ + ++ L
Sbjct: 267 TSDAVPLIGTYFNCIMFMVASSVVLTVVVL 296


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/30 (26%), Positives = 21/30 (70%)
 Frame = -3

Query: 185 SSFSLVVLGTFPLIVMFLLAISLAIRILCL 96
           +S ++ ++GT+   +MF++A S+ + ++ L
Sbjct: 267 TSDAVPLIGTYFNCIMFMVASSVVLTVVVL 296


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -3

Query: 179 FSLVVLGTFPLIVMFLLAISLAIRILC 99
           F L    TF  +V  L+  SLAI +LC
Sbjct: 398 FRLSKTKTFCTLVTALVYCSLAIFVLC 424


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 9/27 (33%), Positives = 12/27 (44%)
 Frame = -3

Query: 584 NWWLELSLKIILKKRQKFIENSTIDTQ 504
           NWW EL  K   K   K   N  ++ +
Sbjct: 96  NWWQELEAKFDPKGEYKQKYNKLLEKE 122


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +1

Query: 118 NEIASKNITMRGNVPKTTKEKED 186
           N ++S N  +RG   KT K +ED
Sbjct: 92  NVVSSTNQEIRGPKRKTWKVEED 114


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 164,665
Number of Sequences: 336
Number of extensions: 3670
Number of successful extensions: 12
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18218375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -