SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    24   1.2  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    24   1.2  
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    24   1.5  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    22   6.2  

>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = -3

Query: 390 YFFVSKTPYASL*QVLGNSTSQ*PHLSG-GAFLAMITSFALPCRRVSKFACILSNI 226
           YFF     Y +  + L         ++G   FLAM+TS  +  +R +    +LSN+
Sbjct: 87  YFFYLSYIYTTYSRKLSGIFKYIDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNL 142


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = -3

Query: 390 YFFVSKTPYASL*QVLGNSTSQ*PHLSG-GAFLAMITSFALPCRRVSKFACILSNI 226
           YFF     Y +  + L         ++G   FLAM+TS  +  +R +    +LSN+
Sbjct: 43  YFFYLSYIYTTYSRKLSGIFKYIDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNL 98


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +2

Query: 335 EFPNTCQRDAYGVLLTKK 388
           +F  TC RD Y +L T K
Sbjct: 419 DFKGTCGRDKYDILRTAK 436


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 19/70 (27%), Positives = 30/70 (42%)
 Frame = +3

Query: 21   LDFSKFHSVSIALTALNKSFYNTYRGY*IHCFILGFISIYASKMVAAKKQKKTIESINSR 200
            LDF K  S+   L+ L KSF   Y    +  F L F+ I  +  +   + + +       
Sbjct: 1299 LDFGKLCSLHHHLSKLIKSFNEIYGVPLLLFFGLNFLIITQAMFLVVGQLQASQIHWQKI 1358

Query: 201  LALVMKSGKY 230
            + +VM S  Y
Sbjct: 1359 IIIVMSSVTY 1368


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,666
Number of Sequences: 336
Number of extensions: 3954
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20546262
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -