SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    23   2.5  
AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless pr...    23   2.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.7  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.7  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    21   7.5  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      21   9.9  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      21   9.9  

>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +1

Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228
           Y W+  + + +R R+ + RY +LE+
Sbjct: 233 YPWMRSQFERKRGRQTYTRYQTLEL 257


>AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless
           protein.
          Length = 325

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +1

Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228
           Y W+  + + +R R+ + RY +LE+
Sbjct: 235 YPWMRSQFERKRGRQTYTRYQTLEL 259


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 510  IFLLDFLKSGLTVWWFSGIHFVYSYDE 430
            +FLL   K  L + W  G+    +YDE
Sbjct: 1283 VFLLTLKKDYLHIKWPFGVKTNITYDE 1309


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 510  IFLLDFLKSGLTVWWFSGIHFVYSYDE 430
            +FLL   K  L + W  G+    +YDE
Sbjct: 1283 VFLLTLKKDYLHIKWPFGVKTNITYDE 1309


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 9/31 (29%), Positives = 12/31 (38%)
 Frame = -2

Query: 529 IFLMYEDLPS*FPQIWAHCMVVQWNPFCLLL 437
           +FL  E      PQ W      QW  +  L+
Sbjct: 180 VFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210



 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 273 QRFHQEHDHRNLS 311
           + FH+EHD R  S
Sbjct: 260 RHFHEEHDTRRAS 272


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 12/26 (46%)
 Frame = -3

Query: 588 CCLRAIQKWARKRQQLGCSQSS*CMR 511
           CC  A+      RQ +  S+   C+R
Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIR 640


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 12/26 (46%)
 Frame = -3

Query: 588 CCLRAIQKWARKRQQLGCSQSS*CMR 511
           CC  A+      RQ +  S+   C+R
Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIR 532


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,271
Number of Sequences: 336
Number of extensions: 3991
Number of successful extensions: 14
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18947110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -