SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    44   1e-06
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    23   3.3  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    23   3.3  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    22   5.7  
AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    21   7.5  
AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase ...    21   9.9  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    21   9.9  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   9.9  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   9.9  
AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    21   9.9  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 44.0 bits (99), Expect = 1e-06
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   L  + +     + +IF  T+R  D+L   +  ++   +++HGD  Q ERE  +  F
Sbjct: 396 KRSKLVSILEKAPNERTLIFVETKRNADFLATFLSEQNIQSTSIHGDRYQSEREKALLDF 455

Query: 221 RTGSSRVLITT 253
           +TG  +VL+ T
Sbjct: 456 KTGHRKVLVAT 466



 Score = 34.3 bits (75), Expect = 0.001
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTE-ADRRALKDIEDFY 438
           ARG+D++ V  VINYDLP + + Y                 +F  E  DR    D+    
Sbjct: 470 ARGLDIKDVQHVINYDLPKSIDEYVHRIGRTGRVGNKGKATSFFDEDQDRNLASDLAKIL 529

Query: 439 HTSIVEMP 462
             +  E+P
Sbjct: 530 SQAKQEIP 537


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +3

Query: 147 CVTLLYLLCME 179
           C+TLLY++C E
Sbjct: 322 CMTLLYIICNE 332


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +3

Query: 147 CVTLLYLLCME 179
           C+TLLY++C E
Sbjct: 322 CMTLLYIICNE 332


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 11/49 (22%), Positives = 20/49 (40%)
 Frame = +1

Query: 493 YIFPILFCVLRSIAIFIRCVY*DKTPNYLTLPNFYWNLFHLDRYIHFRF 639
           Y F   F +     +F+ C+Y    P +  L  +Y+    +   +H  F
Sbjct: 114 YYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFTVHLLF 162


>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 124 IHLATGVAENYSLC 83
           +HLA GV   YS+C
Sbjct: 123 VHLAYGVVIIYSIC 136


>AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase
           protein.
          Length = 268

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = -2

Query: 471 HITGHFNDTSVVEVLNILQCSPVSFS 394
           +  GH+   +   V+  + CSP  FS
Sbjct: 207 YAVGHWMQKATEHVIGCVLCSPGCFS 232


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = -2

Query: 471 HITGHFNDTSVVEVLNILQCSPVSFS 394
           +  GH+   +   V+  + CSP  FS
Sbjct: 521 YAVGHWMQKATEHVIGCVLCSPGCFS 546


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = -2

Query: 471 HITGHFNDTSVVEVLNILQCSPVSFS 394
           +  GH+   +   V+  + CSP  FS
Sbjct: 754 YAVGHWMQKATEHVIGCVLCSPGCFS 779


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = -2

Query: 471 HITGHFNDTSVVEVLNILQCSPVSFS 394
           +  GH+   +   V+  + CSP  FS
Sbjct: 754 YAVGHWMQKATEHVIGCVLCSPGCFS 779


>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = +3

Query: 126 GSLNLCICVTLLYLLCMETWINVSVK 203
           GS+N+ + +T      M T+ NVS++
Sbjct: 53  GSMNMTVAITDKIANFMLTFFNVSLR 78


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,665
Number of Sequences: 336
Number of extensions: 3552
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18947110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -