SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        23   3.6  
AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    23   3.6  
AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory recept...    22   4.8  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    22   6.3  

>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 12/53 (22%), Positives = 28/53 (52%)
 Frame = +2

Query: 566 SAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADIS 724
           S +++ +M+  ++  P+ ++D + +   +TP    +    DN   E KP D++
Sbjct: 445 STSVVGDMLN-MNWNPSAQNDLSGVNLSETPSGISSLLNLDNQQLELKPIDLN 496


>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -3

Query: 186 LSGNTSFSSATGIAKLTAAKAMHNSKTFI 100
           ++ NTS SS+     +TAA  + +S  +I
Sbjct: 161 INNNTSTSSSASSPSVTAAPHLRDSPNYI 189


>AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory receptor
           candidate 58 protein.
          Length = 376

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 26  N*YFT*TICVSVFKSGVAYT 85
           N YF   + +SV+ S V YT
Sbjct: 132 NAYFQLVLSISVYSSSVGYT 151


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 11/36 (30%), Positives = 17/36 (47%)
 Frame = +2

Query: 653 TPEAADAPKLADNPVDEDKPADISPDAPKAEAKSAD 760
           T +    PK     V+ED P+  S  +P+ +  S D
Sbjct: 97  TNQEIRGPKRKTWKVEEDSPSPTSSVSPEVKDSSRD 132


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,766
Number of Sequences: 336
Number of extensions: 2478
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21065107
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -