SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF025669-1|AAB81523.1|  243|Tribolium castaneum GABA receptor su...    24   1.1  
AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    23   2.6  
AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless pr...    23   2.6  
EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    22   4.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.9  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.9  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    21   7.8  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      21   7.8  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      21   7.8  

>AF025669-1|AAB81523.1|  243|Tribolium castaneum GABA receptor
           subunit protein.
          Length = 243

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = -1

Query: 81  FHFFTSQNNFFDTHHGLQTACNIRL 7
           FH  T+ N F   HH      +IRL
Sbjct: 137 FHIATTSNEFIRVHHSGSITRSIRL 161


>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +3

Query: 276 YAWVLDKLKAERERRYHNRYCSLEV 350
           Y W+  + + +R R+ + RY +LE+
Sbjct: 233 YPWMRSQFERKRGRQTYTRYQTLEL 257


>AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless
           protein.
          Length = 325

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +3

Query: 276 YAWVLDKLKAERERRYHNRYCSLEV 350
           Y W+  + + +R R+ + RY +LE+
Sbjct: 235 YPWMRSQFERKRGRQTYTRYQTLEL 259


>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = -2

Query: 272 EGSFTHSWASFSNFSMVRL 216
           EG F   W  F N S+ RL
Sbjct: 392 EGDFIKLWDMFQNESLTRL 410


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = -2

Query: 680  ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 552
            +S  ++ + N L V   FLL   K  L + W  G+    +YDE
Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = -2

Query: 680  ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 552
            +S  ++ + N L V   FLL   K  L + W  G+    +YDE
Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = -1

Query: 66  SQNNFFDTHHGLQT 25
           S  NFF   HGL+T
Sbjct: 175 SAANFFGARHGLET 188


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 8/28 (28%), Positives = 13/28 (46%)
 Frame = -1

Query: 711 CCLRAIQKWARKRQQLGCSQSS*CMRIL 628
           CC  A+      RQ +  S+   C+R +
Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 8/28 (28%), Positives = 13/28 (46%)
 Frame = -1

Query: 711 CCLRAIQKWARKRQQLGCSQSS*CMRIL 628
           CC  A+      RQ +  S+   C+R +
Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,153
Number of Sequences: 336
Number of extensions: 3828
Number of successful extensions: 13
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19675845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -