SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    26   0.25 
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   0.78 
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   2.4  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    22   3.1  
AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase ...    22   4.1  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   4.1  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   4.1  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   4.1  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    21   5.5  
AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    21   5.5  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   7.2  

>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 25.8 bits (54), Expect = 0.25
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = -1

Query: 350 WVRHCCRLLSETIPG 306
           WV H C+L S+ +PG
Sbjct: 493 WVPHSCKLTSKEVPG 507



 Score = 22.6 bits (46), Expect = 2.4
 Identities = 9/33 (27%), Positives = 20/33 (60%)
 Frame = -3

Query: 492 KHFEEL*EPIQLLYHSSGLVSHKDSFDNQMHHV 394
           +H+EE   P+ L +H++ L ++ +  D  ++ V
Sbjct: 411 RHYEENRAPLGLYFHAAWLKNNPEFLDAFLYWV 443


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 24.2 bits (50), Expect = 0.78
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = +3

Query: 324 QQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYP--YVTPTQSYDTTIEWVPTTPQNASI 497
           ++ AA   PG  P P++PR           +  P       +S D+ ++  P  P   S+
Sbjct: 49  EEEAASPTPGDVPTPSSPRS--ISEDPLNCRDLPNSRCNSRESSDSLVQ--PRCPSGESM 104

Query: 498 LSEKQWWLVMKVTMVVPLG 554
           LSE+   L+  V  + P+G
Sbjct: 105 LSERA-ALLRGVPTLSPVG 122


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 9/26 (34%), Positives = 12/26 (46%)
 Frame = +2

Query: 323  TTTCSNVLPRNHASTNCTSRPCDTTW 400
            TTT          +T+ T+RP  T W
Sbjct: 1054 TTTTRRTTTTRPTTTSTTTRPTTTNW 1079


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 4/52 (7%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPY----VTPTQSY 449
           PGY  G   A +  P +   P     H +PH    +  +PY    V PT ++
Sbjct: 14  PGYMDGGAGAGLYEPHVAHRPGLQGLHHSPH--LNHAMHPYHANHVNPTANH 63


>AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase
           protein.
          Length = 268

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +3

Query: 138 TEIENV*ISIRKPKLSPTP 194
           T++    + +R PK+ PTP
Sbjct: 74  TKVHGTTVRVRPPKVYPTP 92


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +3

Query: 138 TEIENV*ISIRKPKLSPTP 194
           T++    + +R PK+ PTP
Sbjct: 388 TKVHGTTVRVRPPKVYPTP 406


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +3

Query: 138 TEIENV*ISIRKPKLSPTP 194
           T++    + +R PK+ PTP
Sbjct: 621 TKVHGTTVRVRPPKVYPTP 639


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +3

Query: 138 TEIENV*ISIRKPKLSPTP 194
           T++    + +R PK+ PTP
Sbjct: 621 TKVHGTTVRVRPPKVYPTP 639


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 171 KPKLSPTPRTNLPIAL 218
           KPK+   P+T LP+ L
Sbjct: 42  KPKMPLLPKTPLPLTL 57


>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 375 PRGHVTPHGA 404
           P G++TPHG+
Sbjct: 250 PTGNITPHGS 259


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 538  IVTFITSHHCFSL 500
            ++TF+ S HC  L
Sbjct: 1249 LITFVMSQHCVEL 1261


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,030
Number of Sequences: 336
Number of extensions: 3367
Number of successful extensions: 12
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13786212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -