SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    25   0.47 
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    23   1.9  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    23   1.9  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    23   1.9  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    22   4.4  
U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic pr...    21   5.8  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          21   5.8  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   5.8  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   5.8  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    21   5.8  
U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.    21   7.7  
AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain tran...    21   7.7  
AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.           21   7.7  

>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 25.0 bits (52), Expect = 0.47
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDS 374
           +  LLK+   + +  R+   +D   +SI+ +N Q   RDS
Sbjct: 387 QIALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDS 426



 Score = 23.4 bits (48), Expect = 1.4
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 8/44 (18%)
 Frame = +2

Query: 152 LQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEI 259
           +  E +   RF H+       ++ +++FA  +PGF +LL +D+I
Sbjct: 345 MDGEDQCDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQI 388


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 12/46 (26%), Positives = 23/46 (50%)
 Frame = -2

Query: 466 YFRVRQIHGIHTFRKLESRINEKLALAPLWMESLFISCPLRQMILL 329
           +++ + I  I    KL++++   L         +FI+C L  +ILL
Sbjct: 99  FYQNKLIEVISKLHKLDNKLKHMLIWKSYKRTQIFITCELFFVILL 144


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 9/36 (25%), Positives = 19/36 (52%)
 Frame = -3

Query: 483 YSQKSPISASVKFMEFIRSANLKVESTRNLHWHRSG 376
           Y + + +   +  +E I+  ++K +   + HW RSG
Sbjct: 129 YKRSNDLKTLLSNLESIQIYSIKPKERNSNHWVRSG 164


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 9/36 (25%), Positives = 19/36 (52%)
 Frame = -3

Query: 483 YSQKSPISASVKFMEFIRSANLKVESTRNLHWHRSG 376
           Y + + +   +  +E I+  ++K +   + HW RSG
Sbjct: 85  YKRSNDLKTLLSNLESIQIYSIKPKERNSNHWVRSG 120


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +2

Query: 221 LIPGFQLLTQDEIHAAQKWSVRCIVRATHLY 313
           LIP F  LTQDE  + +  +V   V    L+
Sbjct: 207 LIPMFLSLTQDEQDSVRLLAVEACVSFASLF 237


>U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic
           protein protein.
          Length = 372

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +2

Query: 359 DEERLHPERCQCKFLVDS 412
           DE+ +HP R + KF + S
Sbjct: 96  DEKFVHPHRFRLKFNISS 113


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +1

Query: 223 HPWLPAADPR 252
           HPW+P  D R
Sbjct: 546 HPWIPLLDTR 555


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +2

Query: 353 ATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGL 472
           + ++  LHP     K     + K   R NS N  + +IGL
Sbjct: 167 SNEDTSLHPSPRITKKANSVSVKVENRRNSPNSCEKKIGL 206


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +2

Query: 353 ATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGL 472
           + ++  LHP     K     + K   R NS N  + +IGL
Sbjct: 115 SNEDTSLHPSPRITKKANSVSVKVENRRNSPNSCEKKIGL 154


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +2

Query: 353 ATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGL 472
           + ++  LHP     K     + K   R NS N  + +IGL
Sbjct: 298 SNEDTSLHPSPRITKKANSVSVKVENRRNSPNSCEKKIGL 337


>U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.
          Length = 322

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 338 HLSQWATDEERLHPERCQCKFLVDST 415
           HLSQ+ T ++ ++PE    K L++ T
Sbjct: 85  HLSQYDTCQQGIYPEN---KTLINET 107


>AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain
           transcription factor Fushitarazu protein.
          Length = 290

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 338 HLSQWATDEERLHPERCQCKFLVDST 415
           HLSQ+ T ++ ++PE    K L++ T
Sbjct: 85  HLSQYDTCQQGIYPEN---KTLINET 107


>AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.
          Length = 290

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 338 HLSQWATDEERLHPERCQCKFLVDST 415
           HLSQ+ T ++ ++PE    K L++ T
Sbjct: 85  HLSQYDTCQQGIYPEN---KTLINET 107


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,945
Number of Sequences: 336
Number of extensions: 2570
Number of successful extensions: 18
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14726181
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -