SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    27   0.16 
AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory recept...    22   4.5  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   7.9  
AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory recept...    21   7.9  

>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 26.6 bits (56), Expect = 0.16
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = -2

Query: 290 VLEAFSYSFNHVSTCEQTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLL 129
           +L  FSY+ N  ST  + + T   +F  PN ++ F  + +T +    KC+K+L+
Sbjct: 10  LLLMFSYTDNVSSTRTKYLRT---NF--PNFYNDFEVQRYTWKCENQKCVKYLV 58


>AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory receptor
           candidate 40 protein.
          Length = 373

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 5/50 (10%)
 Frame = +3

Query: 249 CRNMIKGVTKGFQYKMRAVYAHFPIN-----CVTTEGNSIIEIRNFLGEK 383
           C N   GV   F+ +   ++ + P N     C+TT G  ++ +     EK
Sbjct: 172 CENNSTGVEHFFKKQFHYIFTYMPYNIVFGLCLTTFG--LLPVNGVTSEK 219


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +3

Query: 417 TVVNSPKQKDELIIRQLFRKMSLALVL 497
           TV++  + K  L+   L R ++LALV+
Sbjct: 122 TVIDYKRHKKRLLCYLLARYVALALVI 148


>AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory receptor
           candidate 3 protein.
          Length = 398

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +3

Query: 417 TVVNSPKQKDELIIRQLFRKMSLALVL 497
           TV++  + K  L+   L R ++LALV+
Sbjct: 140 TVIDYKRHKKRLLCYLLARYVALALVI 166


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,415
Number of Sequences: 336
Number of extensions: 3112
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15039504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -