SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless prot...    26   0.26 
U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    25   0.61 
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    23   2.5  
AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholo...    23   2.5  
DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11 pro...    22   5.7  
AF260820-1|AAG02018.1|  139|Tribolium castaneum alpha-esterase l...    22   5.7  
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.9  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.9  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.9  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.9  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.9  

>AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless
           protein.
          Length = 302

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -1

Query: 434 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPLWLVKSP 270
           VL + M  +EP    P++     PGP      F  +N LP    PP+PL  + +P
Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAP 191


>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 25.0 bits (52), Expect = 0.61
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)
 Frame = +2

Query: 302 ESPSTAISLKTR---ISPLSTLDLASSPWLMPV 391
           ESP  A  L  R   I  +ST+DL SS W +P+
Sbjct: 373 ESPPAADELLRRFHEIRYMSTIDLRSSYWQIPL 405


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +2

Query: 173 TCENFRALCTGEK 211
           T ++FR LCTG K
Sbjct: 408 TLDDFRGLCTGNK 420


>AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholog
           protein.
          Length = 406

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = -1

Query: 434 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPL 288
           VL + M  +EP    P++     PGP      F  +N  P    PP+PL
Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPTGFLCNNYPPLPQVPPLPL 185


>DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11
           protein.
          Length = 366

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -2

Query: 205 ASAQGTEVFTRLGSDVTSQLNNNFSQWGIVNSDVE-EY 95
           A   G    ++L + + S   + FSQWG    D++ EY
Sbjct: 110 AILNGIVASSKLRASLISSCLSFFSQWGYDGIDIDWEY 147


>AF260820-1|AAG02018.1|  139|Tribolium castaneum alpha-esterase like
           protein E1 protein.
          Length = 139

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKF-EDENFTL 348
           F + GGDF    G+G   +YG  +   EN  L
Sbjct: 78  FWIHGGDFV--TGSGTSEMYGPDYLMSENVVL 107


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/22 (31%), Positives = 8/22 (36%)
 Frame = +3

Query: 384 CRC*Y*WFPVLHHHCQDLLAGW 449
           C+    WFP    HC      W
Sbjct: 128 CKMDITWFPFDDQHCDMKFGSW 149


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/22 (31%), Positives = 8/22 (36%)
 Frame = +3

Query: 384 CRC*Y*WFPVLHHHCQDLLAGW 449
           C+    WFP    HC      W
Sbjct: 128 CKMDITWFPFDDQHCDMKFGSW 149


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/22 (31%), Positives = 8/22 (36%)
 Frame = +3

Query: 384 CRC*Y*WFPVLHHHCQDLLAGW 449
           C+    WFP    HC      W
Sbjct: 128 CKMDITWFPFDDQHCDMKFGSW 149


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/22 (31%), Positives = 8/22 (36%)
 Frame = +3

Query: 384 CRC*Y*WFPVLHHHCQDLLAGW 449
           C+    WFP    HC      W
Sbjct: 128 CKIDITWFPFDDQHCDMKFGSW 149


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/22 (31%), Positives = 8/22 (36%)
 Frame = +3

Query: 384 CRC*Y*WFPVLHHHCQDLLAGW 449
           C+    WFP    HC      W
Sbjct: 128 CKMDITWFPFDDQHCDMKFGSW 149


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,972
Number of Sequences: 336
Number of extensions: 4320
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18843005
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -