SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    25   0.79 
EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive pep...    24   1.0  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      23   2.4  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      23   2.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   5.6  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.6  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   5.6  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.6  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   7.4  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   7.4  

>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 24.6 bits (51), Expect = 0.79
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = +2

Query: 260 VYPHPAPEGCTSASSESAPSDQPIYPDTG 346
           VYP+     C   + E++ SD P +P  G
Sbjct: 191 VYPNNDGTKCLVVTDEASISDAPFFPHRG 219


>EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive
           peptide receptor 1 protein.
          Length = 374

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 572 LSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLA 691
           L W LF+  +   +GV Y ++ G+SR   + +  T   LA
Sbjct: 30  LLWVLFVIIVAGNVGVLYTLLFGRSRKSRMNYFITHLALA 69


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)
 Frame = +2

Query: 263 YPHP--APEGCTSASSESAPSDQPIYPDTG 346
           YP+P  +PE    A+S   PS  P+ P  G
Sbjct: 172 YPYPILSPEMSQVAASWHTPSMYPLSPGAG 201


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)
 Frame = +2

Query: 263 YPHP--APEGCTSASSESAPSDQPIYPDTG 346
           YP+P  +PE    A+S   PS  P+ P  G
Sbjct: 64  YPYPILSPEMSQVAASWHTPSMYPLSPGAG 93


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 216 ALTNGKVLWPLLEER 172
           A   G V+WP++E+R
Sbjct: 236 AQATGFVVWPIIEQR 250


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 216 ALTNGKVLWPLLEER 172
           A   G V+WP++E+R
Sbjct: 236 AQATGFVVWPIIEQR 250


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 216 ALTNGKVLWPLLEER 172
           A   G V+WP++E+R
Sbjct: 236 AQATGFVVWPIIEQR 250


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 216 ALTNGKVLWPLLEER 172
           A   G V+WP++E+R
Sbjct: 236 AQATGFVVWPIIEQR 250


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +2

Query: 296  ASSESAPSDQPIYPD 340
            ASS  APS  P+ PD
Sbjct: 2288 ASSTMAPSTTPMVPD 2302


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 7/24 (29%), Positives = 14/24 (58%)
 Frame = -1

Query: 540 CAFFFSTSLVTCLCRIGWCWASLV 469
           C ++F  +L+  LC   +C A ++
Sbjct: 284 CIYYFYCALIILLCIYYFCRAFII 307


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,349
Number of Sequences: 336
Number of extensions: 3229
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18634795
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -