SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic pr...    25   1.1  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    23   4.3  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    23   4.3  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    23   4.3  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    22   5.7  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    22   7.5  
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    21   9.9  

>U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic
           protein protein.
          Length = 372

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +1

Query: 307 WDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISA 429
           W K L   Q++ +E FK+  LPL  +K+  K++ +V++  A
Sbjct: 15  WGKSLSIPQQILNE-FKSTLLPLFGLKEQPKIEGKVQVPEA 54


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +1

Query: 643 SPQHGSVLPPVGAXHSGGPTEQFAASNRDT 732
           SP+  S LPP    H   P+  +   NR +
Sbjct: 223 SPKSASSLPPGNNIHGMAPSVMYPHLNRSS 252


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +1

Query: 643 SPQHGSVLPPVGAXHSGGPTEQFAASNRDT 732
           SP+  S LPP    H   P+  +   NR +
Sbjct: 171 SPKSASSLPPGNNIHGMAPSVMYPHLNRSS 200


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +1

Query: 643 SPQHGSVLPPVGAXHSGGPTEQFAASNRDT 732
           SP+  S LPP    H   P+  +   NR +
Sbjct: 354 SPKSASSLPPGNNIHGMAPSVMYPHLNRSS 383


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 22.2 bits (45), Expect = 5.7
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = +2

Query: 599 HEVKPTKPRYD 631
           + +KP+KP+YD
Sbjct: 125 YRIKPSKPKYD 135


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = +3

Query: 372 VGSHQEDHETRRGGEDDISRGTGLIREGC*DFYTRANVASL 494
           +G + +D    RGG  D  RG G   E   +FY    V ++
Sbjct: 84  LGENNDDSGGGRGGGRDGDRGDGGGEEKKREFYIPPEVENV 124


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 5/14 (35%), Positives = 11/14 (78%)
 Frame = -2

Query: 503 VCDQARNVSSCIKI 462
           +CD+A   S+C+++
Sbjct: 335 ICDEAHYASNCLRV 348


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,084
Number of Sequences: 336
Number of extensions: 3542
Number of successful extensions: 11
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24927353
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -