SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4 prot...    23   3.2  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    23   3.2  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    23   3.2  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    23   3.2  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    23   3.2  
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    23   3.2  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           23   3.2  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    23   3.2  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    22   5.6  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   5.6  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   5.6  

>EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4
           protein.
          Length = 475

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +3

Query: 384 NGRQYDIPGSLEEETGHH 437
           N   YD+ GS +  TGHH
Sbjct: 203 NVMAYDLRGSWDGVTGHH 220


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 99  LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 147


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQ--NLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           + S +S+ TS P     + AS ++ S   +  STS   ++   NN+ +S
Sbjct: 143 LTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +3

Query: 396 YDIPGSLEEETGHH 437
           YD  G  E ETGH+
Sbjct: 279 YDFHGKWERETGHN 292


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 8/29 (27%), Positives = 19/29 (65%)
 Frame = +1

Query: 109 SEFDHNSFVTRRRSNRDGSLQFEKQPAVR 195
           S+ DH + +   ++N+DG+   +K+P ++
Sbjct: 452 SQVDHKNNLGDSKNNQDGNNGEKKKPHIK 480


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 8/29 (27%), Positives = 19/29 (65%)
 Frame = +1

Query: 109 SEFDHNSFVTRRRSNRDGSLQFEKQPAVR 195
           S+ DH + +   ++N+DG+   +K+P ++
Sbjct: 344 SQVDHKNNLGDSKNNQDGNNGEKKKPHIK 372


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,598
Number of Sequences: 336
Number of extensions: 3718
Number of successful extensions: 17
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24617054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -