SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16 pro...    23   3.3  
AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3 prot...    23   3.3  
AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    22   7.6  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     22   7.6  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    21   10.0 

>AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16
           protein.
          Length = 384

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +1

Query: 415 IVCWARSASLYVWDQ*SLVAKDGWPNIC 498
           +VC+  S ++Y  D     A D  PN+C
Sbjct: 24  VVCYFASWTIYRPDNGKFTALDTDPNLC 51


>AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3
           protein.
          Length = 384

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +1

Query: 415 IVCWARSASLYVWDQ*SLVAKDGWPNIC 498
           +VC+  S ++Y  D     A D  PN+C
Sbjct: 24  VVCYFASWTIYRPDNGKFTALDTDPNLC 51


>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 406 TAAIVCWARSASLYVWDQ*SLVAKDGWPNIC 498
           T  ++C+  S ++Y  D+     K+  PNIC
Sbjct: 23  TDKVICYVASWAIYRPDKGEYHPKNIDPNIC 53


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = -2

Query: 654 NFIKAMSSPTXSTLYPGQCLASSWQG 577
           N  K +S     TLY     ASSW G
Sbjct: 14  NRCKLLSCKDFDTLYRDCTTASSWPG 39


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -3

Query: 128 RPSHPIPFSFIPVD 87
           +PS  I FS IPVD
Sbjct: 418 KPSFVIQFSHIPVD 431


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,566
Number of Sequences: 336
Number of extensions: 3930
Number of successful extensions: 16
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25134219
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -