SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30159.Seq
         (712 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    25   0.46 
AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    25   0.61 
AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    23   2.5  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    23   2.5  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    23   3.2  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    22   5.7  
DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    21   9.9  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 25.4 bits (53), Expect = 0.46
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = -2

Query: 618 IFRITLFRCTYVYYFYXIRSGVFXXLYFTYYIVPRIYTKH 499
           IF +    CTY +Y+  I   +   +Y+ YY    I+T H
Sbjct: 91  IFTVHFLLCTYYFYYAFI---ILLCVYYFYYAF-IIFTVH 126


>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 25.0 bits (52), Expect = 0.61
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = -3

Query: 641 NFDAQ*PRYFELLYSAVLTFIIFTLLEVVFFXXYILR 531
           +F+A   ++++  YSA+ T I F+L + +      +R
Sbjct: 61  SFEADLRQFYKTAYSAIFTVIDFSLCKAILVHAITIR 97


>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +2

Query: 50  YYS-KVTSYNIMSIXXXXXXXXXXXXYIVNNSNLVFKSLFNVLLIT 184
           Y+S  +TSY ++S+             +V N  L+F   F ++ +T
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALT 102


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +2

Query: 50  YYS-KVTSYNIMSIXXXXXXXXXXXXYIVNNSNLVFKSLFNVLLIT 184
           Y+S  +TSY ++S+             +V N  L+F   F ++ +T
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALT 102


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = -3

Query: 428 VALLSIVFSYSYFCFNSILFRLNLLRRPHKYINYVYPCTK 309
           V+LL +VF + YF +   ++ +         IN+ Y   K
Sbjct: 138 VSLLQLVFVFCYFIYLFTVYYIYYSVHEASIINFGYTLAK 177


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -3

Query: 605 LYSAVLTFIIFTLLEVVFF 549
           +   V  F+IF +L +VFF
Sbjct: 39  IVQTVAYFVIFIILTIVFF 57


>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -2

Query: 201 QYQFVEVINKTLKSD 157
           +YQ +  IN  LKSD
Sbjct: 375 KYQILNAINAALKSD 389


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,039
Number of Sequences: 336
Number of extensions: 2693
Number of successful extensions: 8
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18843005
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -