SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855497-1|ABH88184.1|  127|Tribolium castaneum chemosensory pro...    22   8.1  
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    22   8.1  
AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    22   8.1  

>DQ855497-1|ABH88184.1|  127|Tribolium castaneum chemosensory
           protein 11 protein.
          Length = 127

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 8/25 (32%), Positives = 13/25 (52%)
 Frame = +2

Query: 308 MMRFLRSCLYRNKHVPDSAHVSRHL 382
           +  ++   L + K  PD A + RHL
Sbjct: 43  LKNYVNCLLEKGKCTPDGAELKRHL 67


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -2

Query: 330 HDLKNLIIQGRAEEEINDLE 271
           +D K+   QG+A+ EI DLE
Sbjct: 30  YDSKSHFRQGQAKFEITDLE 49


>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = -2

Query: 471 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 379
           K NS +NGS D +      ++    + NG+K
Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,764
Number of Sequences: 336
Number of extensions: 3760
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 27099446
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -