SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory pro...    24   1.8  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    22   5.5  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       22   7.3  
DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory pro...    22   7.3  
AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esteras...    22   7.3  
AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.      22   7.3  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    21   9.7  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    21   9.7  

>DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory
           protein 6 protein.
          Length = 251

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = +2

Query: 71  PLSPAGVIAKRPAPIALPNSCA 136
           P  P GV  KR  P AL  +CA
Sbjct: 52  PCPPQGVDLKRVLPEALQTNCA 73


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +2

Query: 77  SPAGVIAKRPAPIALPNSCA 136
           +P G   KR  P AL N CA
Sbjct: 54  TPEGEELKRDIPEALQNECA 73


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 11/38 (28%), Positives = 16/38 (42%)
 Frame = -2

Query: 864 IXAPK*IFSIFYFHHVFWVSKNRKXKMPQKGNKAPRKC 751
           +  PK  F   Y HH+ +  +N     P + NK    C
Sbjct: 231 LTCPKCPFITEYKHHLEYHLRNHAGSKPFQCNKCDYTC 268


>DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory
           protein 13 protein.
          Length = 124

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 77  SPAGVIAKRPAPIALPNSCA 136
           +P+G   K+  P AL N CA
Sbjct: 52  TPSGEELKKDIPDALKNECA 71


>AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esterase
           protein.
          Length = 517

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDAPCSGALSAAGV 570
           I E + KN+  G+P  F   V P     G++++  V
Sbjct: 314 IVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSKNV 349


>AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.
          Length = 517

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = -3

Query: 677 IFECI*KNKQIGVPRTFPRKVPPDAPCSGALSAAGV 570
           I E + KN+  G+P  F   V P     G++++  V
Sbjct: 314 IVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSKNV 349


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 8/10 (80%), Positives = 10/10 (100%)
 Frame = -1

Query: 475 SPSSSKSGAP 446
           SPSS+KSG+P
Sbjct: 74  SPSSTKSGSP 83


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 7/25 (28%), Positives = 12/25 (48%)
 Frame = +3

Query: 321 TWTPTSKGEKPSIRAMAHYVNHHPN 395
           TW     G + ++  M  +VN  P+
Sbjct: 271 TWNVVFNGSRKNLDVMKSFVNFRPS 295


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,158
Number of Sequences: 336
Number of extensions: 4223
Number of successful extensions: 14
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24410188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -