SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    25   1.0  
AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   2.3  
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    23   3.1  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   7.1  
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    22   7.1  
AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein p...    22   7.1  
AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein p...    22   7.1  

>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 12/31 (38%), Positives = 15/31 (48%)
 Frame = +1

Query: 526 SSDYCHASPSIRNPLARVVILRVQLADLKLD 618
           + DY      IR  L +V IL   +  LKLD
Sbjct: 144 NKDYVERDTDIRRFLIKVTILHPNIVKLKLD 174


>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = -2

Query: 209 YSTLHFIPFLQDI 171
           YSTLHF+ ++ D+
Sbjct: 210 YSTLHFVNYIDDL 222


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 364 TWRCLTLWYVALT 326
           TWRCL  W V  T
Sbjct: 160 TWRCLYRWIVLYT 172


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 625 ATDKFKRLVGDRYDPKTDLVTIHSGFVVQLKYKTL 729
           A DK+ RLVGD    +  +V +  GF+ +  +K L
Sbjct: 719 AGDKYSRLVGDGSARRRFVVAV-VGFLRRHNFKGL 752


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +1

Query: 391 NTKFPSLNTTSYQEP 435
           N+ FP +N  +Y EP
Sbjct: 92  NSNFPPINHQNYNEP 106


>AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein
           protein.
          Length = 210

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +1

Query: 391 NTKFPSLNTTSYQEP 435
           N+ FP +N  +Y EP
Sbjct: 92  NSNFPPINHQNYNEP 106


>AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein
           protein.
          Length = 253

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +1

Query: 391 NTKFPSLNTTSYQEP 435
           N+ FP +N  +Y EP
Sbjct: 92  NSNFPPINHQNYNEP 106


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,863
Number of Sequences: 336
Number of extensions: 4477
Number of successful extensions: 9
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 23789590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -