SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30151.Seq
         (892 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    24   1.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    23   2.4  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    23   2.4  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    23   3.2  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    22   5.6  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    22   7.4  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   9.8  

>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 18/65 (27%), Positives = 23/65 (35%)
 Frame = -3

Query: 335 RPVRCPKLGR*F*RKPVVVHEDSSQAPEAPRCPXXXXXXXXXXXXXRVIISQRGESGPIF 156
           +P  C K    F R+  +VH       EA R P             R      G  GP+ 
Sbjct: 245 KPFECDKCRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGDAAAARGAARADGAGGPL- 303

Query: 155 ENHRP 141
            +HRP
Sbjct: 304 HDHRP 308


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 811 NPNPGDXXPLIDTT 770
           NPNP +  PLI+ T
Sbjct: 476 NPNPSEENPLINVT 489


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 7/27 (25%), Positives = 19/27 (70%)
 Frame = -1

Query: 436 SENVINNRINETHFLFVLEIDLLWWLA 356
           +EN I++++ + +  F++ + L+W +A
Sbjct: 427 NENTIHSKLCKLYATFLIALKLVWIVA 453


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 9/17 (52%), Positives = 14/17 (82%)
 Frame = +3

Query: 372 KSISRTNKKCVSFILLF 422
           K++ +TNK C +FI+LF
Sbjct: 313 KTVLKTNKYC-NFIILF 328


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = -3

Query: 359 CREDEPLLRPVRCPKLG 309
           C++D P++R     KLG
Sbjct: 176 CQDDTPMVRRAAATKLG 192


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,599
Number of Sequences: 336
Number of extensions: 3828
Number of successful extensions: 12
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24720487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -