SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30150.Seq
         (821 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    24   1.3  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    24   1.3  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    24   1.3  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    23   3.9  
AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory recept...    22   6.8  
AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory recept...    22   6.8  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   8.9  

>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLXMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLXMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 18/65 (27%), Positives = 23/65 (35%)
 Frame = -1

Query: 335 RPVRCPKLGR*F*RKPVVVHEDXSQAPEAPRCPXXXXXXXXXXXXXRVIISQRGESGPIF 156
           +P  C K    F R+  +VH       EA R P             R      G  GP+ 
Sbjct: 245 KPFECDKCRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGDAAAARGAARADGAGGPL- 303

Query: 155 ENHRP 141
            +HRP
Sbjct: 304 HDHRP 308


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 16/61 (26%), Positives = 27/61 (44%)
 Frame = +2

Query: 431 FRYKCVLDQAMDDXEFLADYPQYTGNVT*FGYS*WS*RDVAGRPDQGQSKNALHNYWXAL 610
           +R+   +D      E+ A  P+YT N     Y   +  ++  +  QG SKN  + +W   
Sbjct: 400 YRWHSYIDDIFQ--EYKATLPRYTENQ--LNYPGITVSNIEVQ-SQGSSKNTFNTFWQQS 454

Query: 611 D 613
           D
Sbjct: 455 D 455


>AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory receptor
           candidate 29 protein.
          Length = 429

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +2

Query: 317 WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVF 433
           W  G ++     LC    +V+ E  Q M  + SV  DV+
Sbjct: 324 WSFGFLIVRTVCLCLFGGKVNDESTQPMLVLNSVSADVY 362


>AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory receptor
           candidate 7 protein.
          Length = 429

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +2

Query: 317 WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVF 433
           W  G ++     LC    +V+ E  Q M  + SV  DV+
Sbjct: 324 WSFGFLIVRTVCLCLFGGKVNDESTQPMLVLNSVSADVY 362


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = -1

Query: 359 CREDEPLLRPVRCPKLG 309
           C++D P++R     KLG
Sbjct: 176 CQDDTPMVRRAAATKLG 192


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,206
Number of Sequences: 336
Number of extensions: 2833
Number of successful extensions: 10
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22517873
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -