SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    25   0.77 
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    24   1.3  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    23   2.4  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    23   2.4  
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    22   5.4  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    22   5.4  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    22   5.4  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    22   5.4  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    22   7.2  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    22   7.2  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   9.5  

>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 25.0 bits (52), Expect = 0.77
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = +2

Query: 461 MDDI--EFLADYPQYTGNVT*FGYS*WS*RDVAGRPDQGQSKNALHNYWKALDNHLRK 628
           +DDI  E+ A  P+YT N     Y   +  ++  +  QG SKN  + +W+  D  L +
Sbjct: 406 IDDIFQEYKATLPRYTENQ--LNYPGITVSNIEVQ-SQGSSKNTFNTFWQQSDVDLSR 460


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 18/65 (27%), Positives = 23/65 (35%)
 Frame = -2

Query: 335 RPVRCPKLGR*F*RKPVVVHEDSSQAPEAPRCPXXXXXXXXXXXXXRVIISQRGESGPIF 156
           +P  C K    F R+  +VH       EA R P             R      G  GP+ 
Sbjct: 245 KPFECDKCRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGDAAAARGAARADGAGGPL- 303

Query: 155 ENHRP 141
            +HRP
Sbjct: 304 HDHRP 308


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +3

Query: 354  SASHHSKSISRTNKKCVSFILLFMTFSDINVSWTRP 461
            S S ++ SIS   KK ++++   M+ +   VS  RP
Sbjct: 1403 STSSNNPSISAFRKKSLAYVQQRMSIAPNRVSQARP 1438


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 551 AGRPDQGQSKNALHNYWKALDNH 619
           AGR  +GQ K+ +H + + L  H
Sbjct: 8   AGRASKGQDKHMVHWFRRGLRLH 30


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 7/27 (25%), Positives = 19/27 (70%)
 Frame = -3

Query: 436 SENVINNRINETHFLFVLEIDLLWWLA 356
           +EN I++++ + +  F++ + L+W +A
Sbjct: 427 NENTIHSKLCKLYATFLIALKLVWIVA 453


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = -1

Query: 819 IFLALKRVNPNPXIMAXNGHTLIMRSL 739
           + + L  +  NP IM  NG+  + R L
Sbjct: 364 VHMFLMAIEKNPPIMNLNGYANVNRKL 390


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = -1

Query: 819 IFLALKRVNPNPXIMAXNGHTLIMRSL 739
           + + L  +  NP IM  NG+  + R L
Sbjct: 364 VHMFLMAIEKNPPIMNLNGYANVNRKL 390


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 9/17 (52%), Positives = 14/17 (82%)
 Frame = +3

Query: 372 KSISRTNKKCVSFILLF 422
           K++ +TNK C +FI+LF
Sbjct: 313 KTVLKTNKYC-NFIILF 328


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 2/22 (9%)
 Frame = -1

Query: 777 MAXNGHTL--IMRSLTQCGGNR 718
           M  N H    IMRS+T+ GG R
Sbjct: 567 MVKNSHYKEHIMRSITESGGRR 588


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = -2

Query: 359 CREDEPLLRPVRCPKLG 309
           C++D P++R     KLG
Sbjct: 176 CQDDTPMVRRAAATKLG 192


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,890
Number of Sequences: 336
Number of extensions: 4239
Number of successful extensions: 16
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 23893023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -