SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    26   0.45 
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    21   9.7  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    21   9.7  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    21   9.7  

>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +1

Query: 466 LGVKQLIVGVNKMDSLNHHTVSPDL-RKSRRKYPHTSRRLGYNPAAVAFVPISGWHGD 636
           LG+K L + ++  ++L  + ++P L RKS  KY         +      VPISG H D
Sbjct: 344 LGMKYLDMVIS--ETLRKYPLAPFLNRKSDVKYTFEETGFTLDKGVSIMVPISGLHYD 399


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = -3

Query: 303 GNIVLASFELPESNIDLIP 247
           GNI +  + +P  NI+ +P
Sbjct: 151 GNIAMELWNMPRENIEPLP 169


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -2

Query: 571 MYEDTSFLISSNLGSLYGGSVNPFCLLL 488
           ++ D S ++   LG  Y G  + +CLL+
Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -2

Query: 571 MYEDTSFLISSNLGSLYGGSVNPFCLLL 488
           ++ D S ++   LG  Y G  + +CLL+
Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 210,631
Number of Sequences: 336
Number of extensions: 4518
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24306755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -