SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X72339-1|CAA51066.1|  133|Tribolium castaneum abdominal protein.       24   1.8  
AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A prot...    24   1.8  
AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII pr...    24   1.8  
DQ855504-1|ABH88191.1|  124|Tribolium castaneum chemosensory pro...    22   5.5  
AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    22   5.5  
EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    22   7.3  
DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    22   7.3  
Z69742-1|CAA93624.1|   72|Tribolium castaneum arylphorin protein.      21   9.6  
X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    21   9.6  
U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II p...    21   9.6  
U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I pr...    21   9.6  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   9.6  

>X72339-1|CAA51066.1|  133|Tribolium castaneum abdominal protein.
          Length = 133

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = +2

Query: 236 ISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKK 415
           I+H LC ++   K +    + +LKK     +R   +  ++A+ E E  E+  Q   E ++
Sbjct: 39  IAHALCLTERQIKIWFQNRRMKLKK----ELRAVKEINEQARREREEQERHKQQQQEKQQ 94

Query: 416 ILLQEDPS 439
            + Q+  S
Sbjct: 95  KIEQQTHS 102


>AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A
           protein.
          Length = 284

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = +2

Query: 236 ISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKK 415
           I+H LC ++   K +    + +LKK     +R   +  ++A+ E E  E+  Q   E ++
Sbjct: 190 IAHALCLTERQIKIWFQNRRMKLKK----ELRAVKEINEQARREREEQERHKQQQQEKQQ 245

Query: 416 ILLQEDPS 439
            + Q+  S
Sbjct: 246 KIEQQTHS 253


>AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII
           protein.
          Length = 343

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = +2

Query: 236 ISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKK 415
           I+H LC ++   K +    + +LKK     +R   +  ++A+ E E  E+  Q   E ++
Sbjct: 249 IAHALCLTERQIKIWFQNRRMKLKK----ELRAVKEINEQARREREEQERHKQQQQEKQQ 304

Query: 416 ILLQEDPS 439
            + Q+  S
Sbjct: 305 KIEQQTHS 312


>DQ855504-1|ABH88191.1|  124|Tribolium castaneum chemosensory
           protein 18 protein.
          Length = 124

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 10/37 (27%), Positives = 17/37 (45%)
 Frame = -1

Query: 185 LFRTITCIVIAILIRGIYLGQAKVSNVRHVERLLTNY 75
           +F  +TC  +  L   +      + ++   ERLL NY
Sbjct: 5   VFLVLTCAHVVFLEEYVIPDNIDIDDILSNERLLKNY 41


>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = -1

Query: 248 NCGKWLFASMMHCFQYC 198
           NC   L+A M++C++ C
Sbjct: 718 NCSPDLYAVMLNCWKEC 734


>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 8/28 (28%), Positives = 16/28 (57%)
 Frame = +3

Query: 444 QRPLL*KYVKQLNTVVRGYASEMGTSSP 527
           +RP + KY+ + N VV+ + +     +P
Sbjct: 461 KRPYIYKYLDKKNVVVQSWGASQWPDTP 488


>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +2

Query: 212 NASCWQRAISHNLCYSK 262
           N   WQ +I HNL  +K
Sbjct: 123 NKQGWQNSIRHNLSLNK 139


>Z69742-1|CAA93624.1|   72|Tribolium castaneum arylphorin protein.
          Length = 72

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 657 VWKIRGCARGKEGSGW 704
           +WK+RG   GK+ S W
Sbjct: 4   LWKVRGRCEGKD-SKW 18


>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -2

Query: 586 TVGTQCHHAGSGMPEIYLGAGD 521
           T G+Q    G   P +  G+GD
Sbjct: 126 TAGSQADRDGKNYPAVPYGSGD 147


>U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II
           protein.
          Length = 490

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -2

Query: 586 TVGTQCHHAGSGMPEIYLGAGD 521
           T G+Q    G   P +  G+GD
Sbjct: 127 TAGSQADRDGKNYPAVPYGSGD 148


>U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I
           protein.
          Length = 490

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -2

Query: 586 TVGTQCHHAGSGMPEIYLGAGD 521
           T G+Q    G   P +  G+GD
Sbjct: 127 TAGSQADRDGKNYPAVPYGSGD 148


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -3

Query: 759 PPGGASPINSPVISCQL 709
           PPGG S   S V++C++
Sbjct: 536 PPGGPSSHVSAVLTCKV 552


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 205,656
Number of Sequences: 336
Number of extensions: 4668
Number of successful extensions: 13
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24203322
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -