SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    24   1.4  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    22   5.6  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   5.6  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   5.6  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   5.6  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 7/23 (30%), Positives = 14/23 (60%)
 Frame = -1

Query: 374 DFSNKVRHYKLNLSINYLYWFVL 306
           D   K+RHY + + +N  +W ++
Sbjct: 88  DNEPKLRHYLIFIFVNVFFWVII 110


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = -2

Query: 268 DFHNTNSILVSVVH 227
           DFHN   IL+  +H
Sbjct: 361 DFHNMGHILIGYIH 374


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 3/28 (10%)
 Frame = +2

Query: 23  SPHTA---ALPPRTTRIHNPPTTPIRPN 97
           +PH A    LPP     H PP  P+  N
Sbjct: 726 TPHEAFDVKLPPPPHPHHQPPRNPVGTN 753


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 11/28 (39%), Positives = 13/28 (46%), Gaps = 3/28 (10%)
 Frame = +2

Query: 23  SPHTA---ALPPRTTRIHNPPTTPIRPN 97
           +PH A    LPP     H PP  P+  N
Sbjct: 618 TPHEAFDVKLPPPPHPHHQPPRNPVGTN 645


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.2 bits (45), Expect = 5.6
 Identities = 12/50 (24%), Positives = 19/50 (38%)
 Frame = +2

Query: 2   TPVTEQQSPHTAALPPRTTRIHNPPTTPIRPNNSTLTAMAVGDLFDCNRI 151
           TP++       AA PP  T     P +     ++ L   A    +DC  +
Sbjct: 20  TPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKRAAYDCEGV 69


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,509
Number of Sequences: 336
Number of extensions: 3594
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24513621
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -