SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    26   0.33 
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.76 
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    24   1.8  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    23   3.1  
X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    23   4.1  
U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I pr...    23   4.1  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    23   4.1  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    22   5.4  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    22   5.4  
AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    22   5.4  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   5.4  
DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    21   9.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   9.4  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   9.4  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   9.4  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   9.4  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     21   9.4  

>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 26.2 bits (55), Expect = 0.33
 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 2/66 (3%)
 Frame = +3

Query: 408 PLNPKANREKMTQIMFETFNT-PAMYVAIQAVLSLTRPVVPPVS-CWTPATVSPTPCPST 581
           PL    NR    Q  +      PAM V  +  L   R VVPP   C  P+T+ P P    
Sbjct: 165 PLGKSCNRYWQCQGGYPRLQRCPAMLVFDRRSL---RCVVPPTEDCDVPSTIPPPPPEED 221

Query: 582 RDTHSP 599
            D++ P
Sbjct: 222 DDSNIP 227


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.76
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 306 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 401
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 12/43 (27%), Positives = 22/43 (51%)
 Frame = +3

Query: 480 YVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           Y     V + T  + P ++CW   +++ +P P  + +  PTPS
Sbjct: 304 YSTWSTVQTPTTVMSPTINCW---SLTSSPPPPYQISAQPTPS 343


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 178 GTRREEHHLLRNRP 137
           G R+  HHL++N+P
Sbjct: 82  GVRKVLHHLIKNKP 95


>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -1

Query: 721 ECSRTNFPXGVGNERVAALGENLHEVVCESRP 626
           EC R   P G G  +++   ENL  V   +RP
Sbjct: 43  ECERFLAPKGFGGVQISPPNENL-VVTSSNRP 73


>U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I
           protein.
          Length = 490

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -1

Query: 721 ECSRTNFPXGVGNERVAALGENLHEVVCESRP 626
           EC R   P G G  +++   ENL  V   +RP
Sbjct: 44  ECERFLAPKGFGGVQISPPNENL-VVTSSNRP 74


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = +2

Query: 422 GQQREDDPDHVRNIQHARHVRRHPSRA 502
           GQ    DP+ V   +   H+  HP +A
Sbjct: 903 GQYTTKDPNEVTCDEEEGHISYHPDKA 929


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -1

Query: 178 GTRREEHHLLRNRP 137
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -1

Query: 178 GTRREEHHLLRNRP 137
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 660 SPSAATRSLPTPXG 701
           SP+AA RS+ TP G
Sbjct: 210 SPAAAPRSVATPTG 223


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 275 PDPQIPHRTRNRH 313
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 778 VAFQXVSFRRKFLRXFPGTVQG 843
           ++ Q V+FRRK  +   G +QG
Sbjct: 288 ISNQFVAFRRKIYKWNHGLLQG 309


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 344 MPNLLHVIPVSDDSVFD 294
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 344 MPNLLHVIPVSDDSVFD 294
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 344 MPNLLHVIPVSDDSVFD 294
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 344 MPNLLHVIPVSDDSVFD 294
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = -1

Query: 280 VRIPLLLCAHLLHKSPSVPYRPSRPDG 200
           +++P    AH    SP++P+  +R DG
Sbjct: 117 MQLPHPAAAHSALLSPAMPHNLTRHDG 143


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 204,105
Number of Sequences: 336
Number of extensions: 5051
Number of successful extensions: 24
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23659332
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -