SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    25   0.60 
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    25   0.60 
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    25   0.60 
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    25   0.60 
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    25   0.60 
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           25   0.60 
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    25   0.60 
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    23   3.2  
AY321476-1|AAQ23386.1|  253|Tribolium castaneum Ash protein.           23   4.2  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    23   4.2  
U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.    22   5.5  
AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain tran...    22   5.5  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    21   9.7  

>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 160 MKRVHLGQSTVNANGETKRQRTSYTRYQT 188


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 25.4 bits (53), Expect = 0.60
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  L QSTV++N   +RQR+  T Y++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%)
 Frame = -3

Query: 412 LSRHETASSSHRVANVXPVP---AASKAHTGPAGGATHRPAHSGGGT 281
           L  H  A +  R      VP      +   GPA    H PAH   GT
Sbjct: 303 LHDHRPALAQQRRVAAVQVPQLAGGGRRGPGPARSRRHLPAHLVAGT 349


>AY321476-1|AAQ23386.1|  253|Tribolium castaneum Ash protein.
          Length = 253

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -1

Query: 813 NSGHGHMEWXIIVNNSPNKHXS 748
           NSG G ++     NNSP+++ S
Sbjct: 165 NSGEGSLQENRYYNNSPDQYQS 186


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = +2

Query: 488 CHFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFNQYIFAHVASFVIIWM 667
           CH +G  F++P N+T      L+  + +G   +V+  ILG   F +Y+   V  +   + 
Sbjct: 109 CHTFGR-FLAP-NLTY-----LLVALYSG---YVWTDILGFGYFREYLAEAVQLYFQFYY 158

Query: 668 TILICL 685
           T  +C+
Sbjct: 159 TYFLCV 164


>U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.
          Length = 322

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +3

Query: 150 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           SDC       Q+  H+NE+  R + +   YES
Sbjct: 27  SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57


>AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain
           transcription factor Fushitarazu protein.
          Length = 290

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +3

Query: 150 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           SDC       Q+  H+NE+  R + +   YES
Sbjct: 27  SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQ 227
           M +  L QSTV++N   +RQR++
Sbjct: 204 MKRVHLGQSTVNANGETKRQRTR 226


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,410
Number of Sequences: 336
Number of extensions: 4817
Number of successful extensions: 15
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24410188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -