SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    24   1.3  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   2.3  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    21   7.1  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   9.3  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 4/85 (4%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPE- 443
           +L +Y+  +EG +V+  +  W F      +F     P  +   R  T  +  F+   PE 
Sbjct: 626 DLLEYEAKEEGPKVVCYMTNWAFYRKAEGKFV----PEHI-DQRLCTHVVYAFASLDPEK 680

Query: 444 ---KDYDDLSDLNSMEMESVREWED 509
              K++D  +DL++   E V   +D
Sbjct: 681 LLLKEFDPWADLDNNLYERVTSLKD 705


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +1

Query: 103 FFETLKTLFCQPFIYFVFVSTFVI-LYKFY 189
           +F  +  LFC  FI F     F++ +Y FY
Sbjct: 260 YFYYMHLLFCCAFIIFTMHLLFLLCIYYFY 289



 Score = 21.0 bits (42), Expect = 9.3
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 112 TLKTLFCQPFIYFVFVSTFVILYKFY 189
           T+  LFC  FI+F     F++   ++
Sbjct: 177 TMHLLFCCAFIFFNMHLLFLLCLDYF 202


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
           protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +3

Query: 504 EDNLERIMIWSVDF*GLVKNPGT 572
           ++NL  +MIWS++   L    GT
Sbjct: 340 DNNLAGVMIWSIETDDLHATCGT 362


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.0 bits (42), Expect = 9.3
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 461 QVIIVLFRCC 432
           Q+I+V+F CC
Sbjct: 244 QIILVIFDCC 253


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,253
Number of Sequences: 336
Number of extensions: 3712
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17801955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -