SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esteras...    22   4.1  
AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.      22   4.1  
U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           22   5.5  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   5.5  
AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esteras...    22   5.5  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    22   5.5  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    21   7.2  
AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochr...    21   9.6  

>AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esterase
           protein.
          Length = 517

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = -1

Query: 625 GQYNSVGILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLR--MTSK 476
           G YN V ++F Y   E   +   R      + ++  + + P+ + R  +TSK
Sbjct: 296 GDYNHVPMIFGYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSK 347


>AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.
          Length = 517

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = -1

Query: 625 GQYNSVGILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLR--MTSK 476
           G YN V ++F Y   E   +   R      + ++  + + P+ + R  +TSK
Sbjct: 296 GDYNHVPMIFGYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSK 347


>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +3

Query: 207 RARHRSKRMLPRRLRPQLERINVYYNEASAGK 302
           RA    +R  P+R RP ++R  V    A A +
Sbjct: 319 RATDHQRRNEPKRPRPNIDRHEVTRPAAPANR 350


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 10/26 (38%), Positives = 12/26 (46%)
 Frame = +1

Query: 169 NQIGGKFWEVISDEHGIDPSGCYHGD 246
           N+I  + W V  D  G      YHGD
Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGD 936


>AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esterase
           protein.
          Length = 515

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = -1

Query: 625 GQYNSVGILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLR--MTSK 476
           G YN V ++F Y   E   +   R      + ++  + + P+ + R  +TSK
Sbjct: 294 GDYNHVPMIFGYTTREGMIVEMMRKTETPGMPNDFEEFVHPTVAKRGSITSK 345


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 7/19 (36%), Positives = 10/19 (52%)
 Frame = +1

Query: 181 GKFWEVISDEHGIDPSGCY 237
           G FW +  D   +  +GCY
Sbjct: 211 GSFWSLHPDSGNMFENGCY 229


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +1

Query: 367 PSDAYSDRTISSTDKTVRP 423
           P+    D TI  +D+TVRP
Sbjct: 661 PNMRVQDVTIKFSDRTVRP 679


>AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q2 protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -3

Query: 665 HTNPTLGDLERLKRSV*FCRDTLRV 591
           H  PT  DL+ LK      +++LR+
Sbjct: 34  HAKPTYSDLQNLKYLERCIKESLRL 58


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,751
Number of Sequences: 336
Number of extensions: 3419
Number of successful extensions: 9
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18218375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -