SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    23   2.4  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    23   3.1  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    22   5.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   9.5  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   9.5  

>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +2

Query: 470 YRPIHRDDTFMVRGACAPSSSKWSKQIHHHFASWLLIP 583
           +R + +DDT MVR A A    + ++ +   +    LIP
Sbjct: 172 FRALCQDDTPMVRRAAATKLGELAQVVELEYLKTDLIP 209


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = +1

Query: 508 RGMRAVEFKVVETDPSPFCIVAPD 579
           RG +   +KV E  PSP   V+P+
Sbjct: 102 RGPKRKTWKVEEDSPSPTSSVSPE 125


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = -1

Query: 114 WVCPCDGGSRSINHQGFYYLPFYS 43
           W+C     + S   + FYYLP  S
Sbjct: 49  WICALVNYNVSEISENFYYLPAMS 72


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 417  VLLAIYSKYT*SRTSWRLTVRSIVTTPSWSA 509
            +LL IYS +  +  SW     ++V  P  +A
Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKPDPNA 1047


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 417  VLLAIYSKYT*SRTSWRLTVRSIVTTPSWSA 509
            +LL IYS +  +  SW     ++V  P  +A
Sbjct: 1017 LLLVIYSVFNMNNVSWGTREVTVVPKPDPNA 1047


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,663
Number of Sequences: 336
Number of extensions: 3740
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18114270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -