SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protei...    22   4.0  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    22   4.0  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   9.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   9.2  
AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein p...    21   9.2  

>L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protein
           protein.
          Length = 74

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 444 TG*RTYRCQYC 476
           TG R YRC++C
Sbjct: 33  TGERPYRCEHC 43


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 444 TG*RTYRCQYC 476
           TG R YRC++C
Sbjct: 186 TGERPYRCEHC 196


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +1

Query: 439  AEQAKELIDANTVIVFGFF 495
            A  AKELI+     VF FF
Sbjct: 1255 ARIAKELIELRNKSVFAFF 1273


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +1

Query: 439  AEQAKELIDANTVIVFGFF 495
            A  AKELI+     VF FF
Sbjct: 1255 ARIAKELIELRNKSVFAFF 1273


>AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein
           protein.
          Length = 249

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/32 (25%), Positives = 19/32 (59%)
 Frame = -1

Query: 552 HQQLEQLKGKFWLWLALVRKETKYNNSIGIDK 457
           HQ++E  K  ++     +R++ +  NS+G+ +
Sbjct: 166 HQRVELEKEFYYSRYITIRRKAELANSLGLSE 197


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,701
Number of Sequences: 336
Number of extensions: 2883
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17489640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -