SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    22   3.4  
EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    22   3.4  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     22   4.5  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    21   5.9  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    21   5.9  

>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +1

Query: 433 TQTIKTSSSSACISPLLDVNLSHS 504
           T T  T+SS+   +PL++ N+S S
Sbjct: 11  TTTTTTTSSALNSTPLIEFNISTS 34


>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +1

Query: 433 TQTIKTSSSSACISPLLDVNLSHS 504
           T T  T+SS+   +PL++ N+S S
Sbjct: 11  TTTTTTTSSALNSTPLIEFNISTS 34


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +1

Query: 472 SPLLDVNLSHSPHNARSSTFRIQFFPAYCHKS 567
           SPLL    +HSPH +     ++   PA  H +
Sbjct: 98  SPLLANGYNHSPHLSHMQFMQLP-HPAAAHSA 128


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +3

Query: 150 H*SGKRIYPECTKLLDCGIVVLDYTGCIWTSIL 248
           H  G+ + P  T LL     V  Y+G +WT IL
Sbjct: 110 HTFGRFLAPNLTYLL-----VALYSGYVWTDIL 137


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 74  IFELSLCWRIYHLMRKIRLI 133
           +F + LC R+     KIRLI
Sbjct: 241 LFVIYLCGRVMEEQNKIRLI 260


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,374
Number of Sequences: 336
Number of extensions: 3203
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14830622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -