SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    23   1.8  
AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory recept...    23   1.8  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    23   3.1  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    21   9.4  
AJ005422-1|CAA06528.1|  287|Tribolium castaneum caudal protein p...    21   9.4  
AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein p...    21   9.4  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   9.4  

>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -1

Query: 615 RGPRGPSRRLTRWSWWTANALH 550
           +G RGP  R  R+SW +A  ++
Sbjct: 36  QGVRGPDFRSLRFSWKSARVVY 57


>AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory receptor
           candidate 2 protein.
          Length = 587

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -1

Query: 615 RGPRGPSRRLTRWSWWTANALH 550
           +G RGP  R  R+SW +A  ++
Sbjct: 36  QGVRGPDFRSLRFSWKSARVVY 57


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +3

Query: 480 ETRVWRSSAYFNER 521
           ETR+W  SA F ER
Sbjct: 523 ETRIWPRSAAFAER 536


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = +2

Query: 236 SRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRV 367
           S + +Q   E  P K +++P    I E +   + +  +  +RR+
Sbjct: 47  SNRFKQDAEETVPVKKISIPPLGEILELERDANFSLFIPKHRRI 90


>AJ005422-1|CAA06528.1|  287|Tribolium castaneum caudal protein
           protein.
          Length = 287

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = +2

Query: 251 QSKPEPKPAKGVTVPTRKGIKETQN 325
           QS+P P+PA     P   G   T++
Sbjct: 133 QSQPNPEPADFADAPDAIGKTRTKD 157


>AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein
           protein.
          Length = 249

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 9/25 (36%), Positives = 13/25 (52%)
 Frame = +2

Query: 251 QSKPEPKPAKGVTVPTRKGIKETQN 325
           QS+P P+PA     P   G   T++
Sbjct: 133 QSQPNPEPADFADAPDAIGKTRTKD 157


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein
            protein.
          Length = 1156

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = +1

Query: 436  QNGTAEXXKELXGPPRREFGDRRP 507
            +N  +    +  G PR   GDR+P
Sbjct: 932  RNSASPASSDRSGTPRSTNGDRKP 955


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,071
Number of Sequences: 336
Number of extensions: 1954
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -