SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    26   0.29 
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    24   1.2  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    24   1.2  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    24   1.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   1.6  
AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    23   2.1  
AM712903-1|CAN84642.1|  148|Tribolium castaneum hypothetical pro...    21   8.3  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   8.3  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 25.8 bits (54), Expect = 0.29
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = -2

Query: 457 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLRTLC-LCTH 281
           + L FS    ++     + F +++   F  SE +  +++     YFR +  +T C L T 
Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKTFCTLVTA 412

Query: 280 SSFCGI 263
             +C +
Sbjct: 413 LVYCSL 418


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 282 IVPSVAYAHCSTSSLTKATVTTLST 208
           + PSV Y H + SS T AT    +T
Sbjct: 239 MAPSVMYPHLNRSSPTTATAIASAT 263


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 282 IVPSVAYAHCSTSSLTKATVTTLST 208
           + PSV Y H + SS T AT    +T
Sbjct: 187 MAPSVMYPHLNRSSPTTATAIASAT 211


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -3

Query: 282 IVPSVAYAHCSTSSLTKATVTTLST 208
           + PSV Y H + SS T AT    +T
Sbjct: 370 MAPSVMYPHLNRSSPTTATAIASAT 394


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 8/30 (26%), Positives = 14/30 (46%)
 Frame = +3

Query: 141  WSRHQETCSSPLPRPCPQKHRGT*KGSSLW 230
            W++ ++ C  P    C +K  G    +S W
Sbjct: 1137 WNKERKICDWPKSAKCEEKKPGHKPSTSSW 1166


>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 141 ILDHLTDVLSGVGVCDLI 88
           IL H+    SG+ +CDLI
Sbjct: 252 ILWHIVGTFSGIFLCDLI 269


>AM712903-1|CAN84642.1|  148|Tribolium castaneum hypothetical
           protein protein.
          Length = 148

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 9/17 (52%), Positives = 9/17 (52%)
 Frame = -3

Query: 255 CSTSSLTKATVTTLSTC 205
           CS S L KA  T   TC
Sbjct: 62  CSNSPLRKARYTEKGTC 78


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 11/40 (27%), Positives = 17/40 (42%)
 Frame = -1

Query: 137 LIILRMFCLELVFAISLISFGSNHTFFLPHRITEAASLFC 18
           L I   +C  ++F + L+     + FF    I     LFC
Sbjct: 144 LCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFC 183


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,567
Number of Sequences: 336
Number of extensions: 3337
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15770591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -